Wams.de  |  Nachrichten und aktuelle Informationen aus Politik, Wirtschaft, Sport und Kultur - DIE WELT
Low trust score  | 
Nachrichten und aktuelle Informationen und News aus Politik, Wirtschaft, Finanzen, Wetter, Sport, Fußball, Kultur, Literatur, Reise und Internet

Wams.de Website Information

Wams.de has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 4,565,026, a Majestic Rank of 189,037, a Domain Authority of 56% and is not listed in DMOZ.

Wams.de is hosted by Vodafone GmbH in Mecklenburg-vorpommern, Stralsund, Germany, 18439.
Wams.de has an IP Address of 195.50.176.200 and a hostname of www.welt.de.

The domain wams.de was registered 201 decades 8 years 9 months ago by , it was last modified 4 years 5 months 2 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for wams.de

Full Whois Lookup for Wams.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: wams.de
Nserver: ns1.netuse.de
Nserver: ns2.netuse.de
Nserver: ns4.netuse.de
Dnskey: 257 3 8 AwEAAdSLtmbsgZW5kcJzdvbTu+6xupvx8SBvZhXXVnMf+/HggH8EVrNRVUpHGLdE/caYQrFhxM1SqkZT0Zu+9xqUrLQn1EjUIUymPZP3mm795oaZn4sVteDW0NxHsFLwdwgXR3v3l8SuPmPgHnosconUCCYB2vBh53e2yB3XJ8/c8c/wOzlsEHFMhJlZUNQLWHwimrkdCYtoldOh2+uSrD5hMRaHNX/0I8KOY/PPQL1bgiFedMnMBdMeT6NY/AtRiBCDLJCUr2PRfKnuubI8Cf6Eg3PzJJqQEEfqF/DO4vNZ4HVWzNB2XPBKuC0OYqODhVzXwfZRxk53pIcIAlmARR/L1T8=
Status: connect
Changed: 2016-08-02T16:36:35+02:00

[Tech-C]
Type: PERSON
Name: Axel Springer Role-Account
Organisation: Axel Springer SE
Address: Axel-Springer-Strasse 65
PostalCode: 10888
City: Berlin
CountryCode: DE
Phone: +49.4034726339
Fax: +49.4034716339
Email: Login to show email
2015-02-11T15:48:11+01:00

[Zone-C]
Type: PERSON
Name: Axel Springer Role-Account
Organisation: Axel Springer SE
Address: Axel-Springer-Strasse 65
PostalCode: 10888
City: Berlin
CountryCode: DE
Phone: +49.4034726339
Fax: +49.4034716339
Email: Login to show email
2015-02-11T15:48:11+01:00

Who hosts Wams.de?

Wams.de Web Server Information

Hosted IP Address:195.50.176.200
Hosted Hostname:www.welt.de
Service Provider:Vodafone GmbH
Hosted Country:GermanyDE
Location Latitude:54.302
Location Longitude:13.093
Webserver Software:unknown

HTTP Header Analysis for Wams.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: max-age=60
Content-Type: text/html;charset=UTF-8
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 60223
Accept-Ranges: bytes
Access-Control-Allow-Origin: *
Access-Control-Allow-Methods: POST, GET, PUT, OPTIONS, HEAD
Access-Control-Max-Age: 86400
Date: Tue, 13 Oct 2015 08:43:30 GMT
Connection: keep-alive


Need to find out who hosts Wams.de?

Wams.de Free SEO Report

Website Inpage Analysis for Wams.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Wams.de

iffuball0technikdazuhateinermeinungmenschensind diepolitikunsererdeutschlanderstezukunfttypestehenkulturichwien24millionendesfrinternationalbundesligawirtschaftjahrwurdenpsychologiedigitalschauspielerinps weltvor allemneuenbreisestefandeutschenbleibt22082017 group 8lebendochnicht mehrsieuhr grouppolizeiamp technik6upnordkoreageschichtefist22082017 groupauf demdannligaeurodiesemseinenjetztberlinerwirklichamppltzlichlinkeaufausland22082017 wirtschaftseinwhlervielkritikwennchevronwissenwarummusskeinegibtihrknnenmitgutsollwebwelt amp technikthisreadystatealsgroup 8amtageseinem2mfragemancgehtallemihmschonmerkeloffenbarkwerdenderbvariationnamegeldnachseitdes tagesbarcelonabilderzeigtunterkommtzurneuedie bestendemokratietypeofvar0703 uhrunserelogopanoramaaus derparteizwei5oderuhr fuballbergibt esthomasfrauenwurdegeldanlagedeutschegemachtsindwie einfernreisenvon stefanimmerbayerneinengroemin nochnochpsweitereerdoganheuteuhrniehieranderezumannkinder4wervonseinebilanzgeht espromiseresolvecurljscorethenfunctiones frdennklarewebwelt ampfastobnach demhaus0812gebenhabendie linkedemzumdassden usamachtsexuellesollte1jedersoeinchristophzeit21082017 meinungnunmit dermediathekbestenerwebweltfordertdiediesebundestagswahldiesenhomewaraus demesvomusanewstickerganzaberundefined typeofmehrihreihrerweltgesellschaftgesundheitsport0703mnnernichtauf derwird es22082017 panoramavorfr diedenhaben diewirdfranknurgegenfcabbilder desuhr group 8abschiebungdasgrteeuropabrauchtdie deutschennach denundefinedimagelsstmit demgroupvieleist nicht3dabeifunctiontagegarallesfalltvminkmpktschwarzeeinesauchimumkanntrumpsichbeiforscherepaperbeimweimachenfitnessstehtvorbeidie weltbilder des tagesausnichtsuhr deutschlandeine

Longtail Keyword Density for Wams.de

KeywordsOccurences
22082017 group 88
uhr group 86
bilder des tages4
webwelt amp technik4
group 824
22082017 group8
gibt es6
uhr group6
21082017 meinung6
min noch5
auf dem5
des tages5
aus dem5
nach dem5
mit der5
mit dem5
webwelt amp4
ps welt4
auf der4
fr die4
bilder des4
amp technik4
ist nicht4
nach den4
haben die4
22082017 wirtschaft4
die deutschen4
0703 uhr3
uhr deutschland3
sind die3
es fr3
die linke3
die welt3
den usa3
undefined typeof3
von stefan3
nicht mehr3
22082017 panorama3
uhr fuball3
vor allem3
geht es3
aus der3
die besten3
wie ein3
wird es3
die134
von102
der99
das44
040
ist40
ein36
eine36
auf32
fr31
mit31
sie30
den29
es28
zu27
dem26
group24
124
uhr23
amp23
nicht22
sich22
im21
wie20
als19
nach19
noch18
meinung17
welt16
auch15
mehr15
wird15
er14
hat13
des13
213
doch12
aus12
werden11
so11
leben11
zum11
sind10
deutschland10
aber10
vor10
nur10
haben9
oder9
jetzt9
deutschen9
gegen8
eines8
einen8
einem8
wer8
um8
function8
gibt8
panorama8
nun8
wirtschaft8
bundestagswahl8
war8
var8
politik8
ausland8
geht8
zur7
am7
machen7
geld7
dabei7
fuball7
ob7
zwei7
zeigt7
ber7
ihr6
trump6
diese6
man6
besten6
bei6
technik6
deutsche6
kann6
wissen6
beim5
alles5
zukunft5
knnen5
immer5
gar5
einer5
offenbar5
warum5
sport5
muss5
wenn5
millionen5
soll5
ihrer5
if5
nordkorea5
sein5
geschichte5
kultur5
tages5
ihre5
mediathek5
min5
ab5
tage5
viele5
usa5
bundesliga5
seinen5
neue5
heute5
34
wurde4
bilanz4
hier4
steht4
barcelona4
bilder4
ps4
bvariationname4
gesundheit4
schon4
polizei4
44
mnner4
pltzlich4
gut4
ganz4
home4
wei4
whler4
menschen4
nichts4
schwarze4
webwelt4
frauen4
viel4
diesen4
jahr4
vom4
partei4
erste4
n244
frage4
wirklich4
tv4
b4
abschiebung4
seit4
dass4
merkel4
erdogan4
digital4
seine3
denn3
dazu3
wurden3
image3
newsticker3
promiseresolvecurljscorethenfunction3
linke3
geben3
kmpkt3
f3
thisreadystate3
k3
typeof3
undefined3
c3
unserer3
unsere3
ich3
mann3
sollte3
euro3
nie3
berliner3
schauspielerin3
grte3
thomas3
forscher3
sexuelle3
frank3
allem3
haus3
zeit3
type3
up3
chevron3
ihm3
lsst3
christoph3
kritik3
braucht3
diesem3
m3
bayern3
53
liga3
fitness3
geldanlage3
epaper3
international3
psychologie3
fernreisen3
europa3
reise3
gesellschaft3
07033
vorbei3
demokratie3
neuen3
groe3
unter3
fc3
bleibt3
kommt3
stehen3
klare3
dann3
weitere3
kinder3
63
gemacht3
logo3
fast3
jeder3
keine3
fall3
macht3
08123
andere3
fordert3
stefan3

What are the nameservers for wams.de?

Wams.de Domain Nameserver Information

HostIP AddressCountry
ns1.netuse.de 195.244.244.10Germany Germany
ns2.netuse.de 195.244.235.10Germany Germany
ns4.netuse.de 212.12.39.198Germany Germany

Wams.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wams.de is a scam?