Wandsworth.gov.uk Website Information

Wandsworth.gov.uk has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 158,567, a Majestic Rank of 85,205, a Domain Authority of 96% and is not listed in DMOZ.

Wandsworth.gov.uk is hosted by Rackspace Ltd. in England, Eton, United Kingdom, Sl4 6aw.
Wandsworth.gov.uk has an IP Address of 134.213.21.171 and a hostname of 134.213.21.171 and runs HTTP_Server web server.

The domain wandsworth.gov.uk was registered 2 decades 3 years 2 months ago by , it was last modified 201 decades 9 years 10 hours ago and currently is set to expire 201 decades 9 years 10 hours ago.


Whois information for wandsworth.gov.uk

Full Whois Lookup for Wandsworth.gov.uk Whois Lookup

Domain name:
gov.uk

Registrant:
UK Cabinet Office

Registrant type:
UK Government Body

Registrant's address:
Government Digital Service
Aviation House, 6th floor
125 Kingsway
London
WC2B 6NH
GB

Registrar:
No registrar listed. This domain is directly registered with Nominet.

Relevant dates:
Registered on: before Aug-1996
Registration status:
No registration status listed.

Name servers:
ns0.ja.net.
ns2.ja.net.
ns3.ja.net.
ns4.ja.net.
auth50.ns.de.uu.net.
auth00.ns.de.uu.net.
ns1.surfnet.nl.

WHOIS lookup made at 12:08:21 20-Oct-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Wandsworth.gov.uk?

Wandsworth.gov.uk Web Server Information

Hosted IP Address:134.213.21.171
Hosted Hostname:134.213.21.171
Service Provider:Rackspace Ltd.
Hosted Country:United KingdomGB
Location Latitude:51.4883
Location Longitude:-0.60905
Webserver Software:HTTP_Server

HTTP Header Analysis for Wandsworth.gov.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 14 Jul 2015 06:56:50 GMT
Server: HTTP_Server
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-UA-Compatible: IE=edge,chrome=1
X-Frame-Options: SAMEORIGIN
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 7104
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Wandsworth.gov.uk?

Wandsworth.gov.uk Free SEO Report

Website Inpage Analysis for Wandsworth.gov.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Wandsworth.gov.uk

more servicesstreetmoreserviceswandsworthtownapplyhousingliparkingfontsizetaxjobsopenzampcontrolwebsiteourfindcouncilbuilding controlbuildingupcentressocialasideleftnavserviceparksplanningnewsyourcouncil taxwandsworth council

Longtail Keyword Density for Wandsworth.gov.uk

KeywordsOccurences
wandsworth council4
council tax4
more services3
building control3
council12
wandsworth7
planning6
your5
find5
street5
more4
tax4
housing4
services4
parking4
our4
news4
asideleft-nav3
jobs3
town3
z3
social3
li3
font-size3
amp3
centres3
parks3
control3
building3
service3
up3
open3
apply3
website3

What are the nameservers for wandsworth.gov.uk?

Wandsworth.gov.uk Domain Nameserver Information

HostIP AddressCountry
ns0.ja.net 193.63.94.20United Kingdom United Kingdom
ns2.ja.net 193.63.105.17United Kingdom United Kingdom
ns3.ja.net 193.63.106.103United Kingdom United Kingdom
ns4.ja.net 193.62.157.66United Kingdom United Kingdom
auth50.ns.de.uu.net 194.128.171.99United Kingdom United Kingdom
auth00.ns.de.uu.net 192.76.144.14Germany Germany
ns1.surfnet.nl 192.87.106.101Netherlands Netherlands

Wandsworth.gov.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wandsworth.gov.uk is a scam?