Wawerko.de Favicon Wawerko.de

Wawerko.de Website Thumbnail
Checking...
Low trust score
 | 
Add a review Change category Claim this site

Domain summary

Domain label
wawerko
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is wawerko.de ranked relative to other sites:

Percentage of visits to wawerko.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wawerko.de registered?
A: Wawerko.de was registered 1 week, 3 hours, 59 minutes, 58 seconds ago on Wednesday, September 23, 2020.
Q: When was the WHOIS for Wawerko.de last updated?
A: The WHOIS entry was last updated 7 years, 5 months, 3 weeks, 1 day, 3 hours, 59 minutes, 58 seconds ago on Monday, April 8, 2013.
Q: What are Wawerko.de's nameservers?
A: DNS for Wawerko.de is provided by the following nameservers:
  • cns1.alfahosting.info
  • cns2.alfahosting.info
  • cns3.alfahosting.info
Q: Who is the registrar for the Wawerko.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Wawerko.de?
A: Wawerko.de has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Wawerko.de each day?
A: Wawerko.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Wawerko.de resolve to?
A: Wawerko.de resolves to the IPv4 address 212.23.152.236.
Q: In what country are Wawerko.de servers located in?
A: Wawerko.de has servers located in the Germany.
Q: What webserver software does Wawerko.de use?
A: Wawerko.de is powered by Nginx/1.10.2 webserver.
Q: Who hosts Wawerko.de?
A: Wawerko.de is hosted by Telekommunikation Mittleres Ruhrgebiet GmbH in Rheinland-pfalz, Bendorf, Germany, 56170.
Q: How much is Wawerko.de worth?
A: Wawerko.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Wawerko.de?

Wawerko.de Hosting Provider Information

Hosted IP Address:212.23.152.236
Hosted Hostname:webserver1.wawerko.de
Service Provider:Telekommunikation Mittleres Ruhrgebiet GmbH
Hosted Country:GermanyDE
Location Latitude:50.4229
Location Longitude:7.5792
Webserver Software:nginx/1.10.2

Is "Telekommunikation Mittleres Ruhrgebiet GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Wawerko.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.2
Date: Wed, 23 Sep 2020 12:32:07 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.3.10-1ubuntu3.26
P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Content-Encoding: gzip

Wawerko.de Domain Nameserver Information

HostIP AddressCountry
cns1.alfahosting.info 109.237.142.8
cns2.alfahosting.info 148.251.254.105
cns3.alfahosting.info 109.237.143.8


Need to find out who hosts Wawerko.de?


WhoIs information for Wawerko.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: wawerko.de
Nserver: cns1.alfahosting.info
Nserver: cns2.alfahosting.info
Nserver: cns3.alfahosting.info
Status: connect
Changed: 2013-04-08T21:03:40+02:00

Wawerko.de Free SEO Report

Website Inpage Analysis for Wawerko.de

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wawerko.de

diessiemachenzeitmenscheneinenauf derden bodenwirdgartendassaberbiseinvonbodensoeinemmit demetwaswenn mansollteflaschenvomgartenbeetleichtauf dendie meistenschaffenwennseinmit dervieleeinfachdieserwie manmitgemachtwiedermsozurwintersollte manum dieblumentopfnbspderstylepflanzenfreuchnunverwendenanleitungist einman diebesserflaschesplenstehenschonkannim gartennichtvordermannamsommervorkann manein paaranleitungengutnurschreibenzumalsdesistmehrbeifr denfalseaufnochbastelnpaareinefrhlingdie flaschenumdaszeigemeistenwerdensuchenauf vordermannselber machenselberfrhstcknachnatrlichmusstischdabeidemauswerkzeugampzusehenwievarkleinentippsdanneinerimmanesgibthattagdiyknnensichneusindmalman diesemit einemkommtist dasschnimmerdiesedendieplatzganzichfuumlrgehtauchoder

Longtail Keyword Density for Wawerko.de

KeywordsOccurences
kann man8
ist das7
ein paar6
selber machen5
die flaschen5
im garten5
man die4
den boden4
auf den4
mit der4
mit einem4
mit dem4
wie man4
sollte man4
fr den3
die meisten3
man diese3
ist ein3
auf der3
auf vordermann3
um die3
wenn man3
die58
der47
man37
ist27
von26
ein24
das23
den22
im22
mit22
kann18
auch16
aus16
selber15
auf15
garten14
sie13
oder12
nicht12
zu12
dem12
es12
wenn11
einem11
so10
flaschen10
ich10
dann10
fr10
wie9
einen9
am8
fuumlr8
werden8
als7
hat7
mehr7
aber7
machen7
einer7
einfach6
frhling6
wieder6
boden6
wird6
diese6
dass6
paar6
noch6
mal6
neu6
sich6
um6
dieser5
gut5
vor5
tag5
gartenbeet5
eine5
zur5
sollte5
nur5
anleitungen5
knnen4
platz4
tisch4
amp4
verwenden4
euch4
geht4
kommt4
nach4
false4
viele4
bei4
schn3
basteln3
zum3
schaffen3
stehen3
mso3
des3
leicht3
gemacht3
menschen3
style3
natrlich3
var3
etwas3
splen3
ganz3
kleinen3
frhstck3
nbsp3
suchen3
immer3
diy3
winter3
dabei3
schon3
nun3
vordermann3
sommer3
zeit3
sind3
sehen3
muss3
schreiben3
werkzeug3
anleitung3
bis3
meisten3
tipps3
blumentopf3
zeige3
sein3
pflanzen3
besser3
vom3
flasche3
gibt3
dies3

Wawerko.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wawerko.de is a scam?

Websites with Similar Names

Wawer.warszawa.pl
Dzielnica Wawer
Wawerubrian.us
Wawerubrian Stores — Your Any Day & Everyday Shopping Friend

Recently Updated Websites

Separazione-torino.com 1 second ago.Ssytk.com 2 seconds ago.Joansportsclub.com 3 seconds ago.Cost05.com 3 seconds ago.Edenalt.org 3 seconds ago.Thomaslaupstad.com 3 seconds ago.Mappian.com 4 seconds ago.Fitforlife-fitness.at 4 seconds ago.Biosextube.com 4 seconds ago.Fincasandhouses.com 4 seconds ago.Jeanneret-design.com 5 seconds ago.Robyngrady.com 5 seconds ago.Beesocialmarketing.co.uk 6 seconds ago.Online-web-dir.com 6 seconds ago.Oldfuck.com 6 seconds ago.Torahlifeministries.org 6 seconds ago.Thereisnoline.com 7 seconds ago.Leesvoer.net 7 seconds ago.Stevemcghee.com 8 seconds ago.Diccionariomedico.org 9 seconds ago.Myfelts.com 10 seconds ago.Jiantaoshu500.com 10 seconds ago.Materacollection.com 10 seconds ago.Anzavet.com 11 seconds ago.Bartonwilder-client.com 11 seconds ago.Elan4dance.com 11 seconds ago.Ukraina-hotel.ru 11 seconds ago.Anniskelupassi.fi 12 seconds ago.Amyksorrells.com 14 seconds ago.Moviedownloadall.com 14 seconds ago.