Wayup.name Favicon Wayup.name

Wayup.name Website Thumbnail
Checking...
Heilpraktiker Oliver Bruno Schmid, Naturheilpraxis, 91541 Rothenburg, Rothenburg ob der Tauber, Hornburgweg 10, Telefon 09861 92599, Chiropraktik, Osteopathie, Schmerztherapie, Dorn, Dieter Dorn, Dorn-Therapie, Dorn-Methode, Dorn-Seminar, Dorn-Schule, Dorn-Lehrer, Dorn-Ausbilder, Dorn-Ausbildung, Dorn-Kurs, Orthopädie, Sportmedizin, Alternative Medizin, Alternative Orthopädie, Homöopathie, Dunkelfeld-Mikroskopie,

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet

wayup, praxis, naturheilpraxis, naturheilpraxis oliver bruno schmid, 91541, rothenburg, rothenburg.de, 91541 rothenburg, rothenburg ob der tauber, heilpraktiker, rothenburg heilpraktiker, soft chiropraktik, oliver b. schmid, heilpraktiker oliver bruno schmid, oliver bruno schmid, chiro, chiropraktik, chiro praktik, chiropraktiker, schmerz therapie, schmerztherapie, chiropraktik rothenburg, rothenburg chiropraktik, osteopathie, osteopath, softchiropraktik, softchiropraktiker, soft chiropraktiker, softchiropraktikerin, soft chiropraktikerin, osteopathei, rolfing, cranio sacral therapie, kranio sakral therapie, migräne, rücken schmerzen, gelenk schmerzen, kreuz schmerzen, dorn, dieter dorn, dorn therapie, dorn methode, dornbehandlung, dorn seminar, dorn seminare, dorn aufbauseminar, dorn schule, dorn lehrer, dorn deutschland, dorn welt, dorn world, dorn ausbilder, dorn kongress, dieter dorn seminar, dorn bewegt, dorn bewegung, dorn behandlung, dorn behandler, homöopathie, homoeopathie, homöopath, orthopädie, osteopädie, osteopäde, augen diagnose, augendiagnose, iris diagnose, irisdiagnose, gesund, gesundheit, gesundheitspraxis, wellness, wellness massage, wellnessmassage, fit, fitness, fitness training, fitnesstraining, kraft, energie, lebenskraft, nerven, psyche, gespräche, psychotherapie, therapie, psychologie, psycho therapie, psycho therapeut, psychotherapeut, psychisch, licht, liebe, glaube, hoffnung, gott, jesus christus, gott heiliger geist, heile, heilen, heilung, heiler, heilerei, engel, schutzengel, helfer, rettung, hilfe, helfen, die kraft der liebe, einrenken, einrenker, einrenkung, einrenkende, einrenkerei  Show all keywords

Domain summary

Domain label
wayup
Domain extension
name
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is wayup.name ranked relative to other sites:

Percentage of visits to wayup.name from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wayup.name registered?
A: Wayup.name was registered 3 weeks, 4 days, 20 hours, 58 minutes, 14 seconds ago on Friday, October 30, 2020.
Q: When was the WHOIS for Wayup.name last updated?
A: The WHOIS entry was last updated 3 weeks, 4 days, 20 hours, 58 minutes, 14 seconds ago on Friday, October 30, 2020.
Q: What are Wayup.name's nameservers?
A: DNS for Wayup.name is provided by the following nameservers:
  • dns02-tld.t-online.de
  • dns01-tld.t-online.de
Q: Who is the registrar for the Wayup.name domain?
A: The domain has been registered at .
Q: What is the traffic rank for Wayup.name?
A: Wayup.name has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Wayup.name each day?
A: Wayup.name receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Wayup.name resolve to?
A: Wayup.name resolves to the IPv4 address 80.150.6.143.
Q: In what country are Wayup.name servers located in?
A: Wayup.name has servers located in the Germany.
Q: What webserver software does Wayup.name use?
A: Wayup.name is powered by webserver.
Q: Who hosts Wayup.name?
A: Wayup.name is hosted by The Globaltap Corporation in North Rhine-westphalia, Düsseldorf, Germany, 40474.
Q: How much is Wayup.name worth?
A: Wayup.name has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Wayup.name?

Wayup.name Hosting Provider Information

Hosted IP Address:80.150.6.143
Hosted Hostname:tld.t-online.de
Service Provider:The Globaltap Corporation
Hosted Country:GermanyDE
Location Latitude:51.2674
Location Longitude:6.7442
Webserver Software:Not Applicable

Is "The Globaltap Corporation" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
The Globaltap Corporation
0.0121%

HTTP Header Analysis for Wayup.name

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
cache-control: no-store
content-type: text/html; charset=utf-8
date: Fri, 30 Oct 2020 10:48:46 GMT
p3p: CP="CAO PSA OUR"
Transfer-Encoding: chunked

Wayup.name Domain Nameserver Information

HostIP AddressCountry
dns02-tld.t-online.de 217.237.160.27
dns01-tld.t-online.de 212.185.250.107


Need to find out who hosts Wayup.name?


Domain Registration (WhoIs) information for Wayup.name

 Disclaimer: VeriSign, Inc. makes every effort to maintain the
completeness and accuracy of the Whois data, but cannot guarantee
that the results are error-free. Therefore, any data provided
through the Whois service are on an as is basis without any
warranties.
BY USING THE WHOIS SERVICE AND THE DATA CONTAINED
HEREIN OR IN ANY REPORT GENERATED WITH RESPECT THERETO, IT IS
ACCEPTED THAT VERISIGN, INC. IS NOT LIABLE FOR
ANY DAMAGES OF ANY KIND ARISING OUT OF, OR IN CONNECTION WITH, THE
REPORT OR THE INFORMATION PROVIDED BY THE WHOIS SERVICE, NOR
OMISSIONS OR MISSING INFORMATION. THE RESULTS OF ANY WHOIS REPORT OR
INFORMATION PROVIDED BY THE WHOIS SERVICE CANNOT BE RELIED UPON IN
CONTEMPLATION OF LEGAL PROCEEDINGS WITHOUT FURTHER VERIFICATION, NOR
DO SUCH RESULTS CONSTITUTE A LEGAL OPINION. Acceptance of the
results of the Whois constitutes acceptance of these terms,
conditions and limitations. Whois data may be requested only for
lawful purposes, in particular, to protect legal rights and
obligations. Illegitimate uses of Whois data include, but are not
limited to, unsolicited email, data mining, direct marketing or any
other improper purpose. Any request made for Whois data will be
documented by VeriSign, Inc. but will not be used for any commercial purpose whatsoever.

****

No match for "WAYUP.NAME".

>>> Last update of whois database: 2017-09-17T19:02:09Z

Wayup.name Free SEO Report

Website Inpage Analysis for Wayup.name

H1 Headings

1 :
  1. Immunsystem-Aufbautherapie, Schmerz-Therapie

H2 Headings

1 :
  1. Ursachen ganzheitlich behandeln, lindern, heilen

H3 Headings

0 :

H4 Headings

2 :
  1. Externe Inhalte
  2. Cookie-Einstellungen

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

54:
  1. Wayup HEILPRAKTIKER OLIVER B. SCHMID
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID
  2. Wayup UNTERSUCHUNG
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/UNTERSUCHUNG
  3. Wayup BEHANDLUNG
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/BEHANDLUNG
  4. Wayup AKTUELLES
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/AKTUELLES
  5. Wayup Über mich, Therapie-Grundlagen
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/Ueber-mich,-Therapie-Grundlagen
  6. Wayup KRAFTSCHÖPFUNG
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/KRAFTSCHOePFUNG
  7. Wayup Erfolgreiche Behandlungen
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/Erfolgreiche-Behandlungen2/
  8. Wayup ALTERNATIVE-MEDIZIN+ORTHOPÄDIE
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE
  9. Wayup HOMÖOPATHIE, NATIVEBLUT-THERAPIE NACH PROF. ENDERLEIN, DR. SCHÜSSLER BIOCHEMIE
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/HOMOeOPATHIE,-NATIVEBLUT-THERAPIE-NACH-PROF-ENDERLEIN,-DR-SCHUeSSLER-BIOCHEMIE
  10. Wayup Die sanfte SOFT-CHIROPRAKTIK, Osteopathie, Kranio-Sakral-Therapie, Dornbehandlung
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/Die-sanfte-SOFT-CHIROPRAKTIK,-Osteopathie,-Kranio-Sakral-Therapie,-Dornbehandlung
  11. Wayup NATURHEILKUNDE, ALTERNATIVE SPORTHEILKUNDE, KINESIOLOGISCHE SELBSTAUFRICHTUNG, GANZHEITLICHE HEILMASSAGE
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/NATURHEILKUNDE,-ALTERNATIVE-SPORTHEILKUNDE,-KINESIOLOGISCHE-SELBSTAUFRICHTUNG,-GANZHEITLICHE-HEILMASSAGE
  12. Wayup KINDER-HEILKUNDE, DIE ALTERNATIVE
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/KINDER-HEILKUNDE,-DIE-ALTERNATIVE
  13. Wayup AKUPUNKTUR, Akupressur, Spannungs-Ausgleichs-Massage; Heilhypnose;
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/AKUPUNKTUR,-Akupressur,-Spannungs-Ausgleichs-Massage-Heilhypnose
  14. Wayup Alternative IMMUNTHERAPIE, Begleitende Krebstherapie,
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/Alternative-IMMUNTHERAPIE,-Begleitende-Krebstherapie,
  15. Wayup ERNÄHRUNGS- und UMWELT-MEDIZIN, Abnehmen, Testungen, Allergene, Zahnmaterialien
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/ERNAeHRUNGS-und-UMWELT-MEDIZIN,-Abnehmen,-Testungen,-Allergene,-Zahnmaterialien
  16. Wayup Gesprächstherapie, psychologische Beratung; ganzheitliche energetische Aufrichtung; brückenbauende Sterbebegleitung;
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/Gespraechstherapie,-psychologische-Beratung-ganzheitliche-energetische-Aufrichtung-brueckenbauende-Sterbebegleitung
  17. Wayup ZELLREGENERATION, KUR, FACE-FORM-ÄSTHETIK
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE/ZELLREGENERATION,-KUR,-FACE-FORM-AeSTHETIK
  18. Wayup GANZ. HEILEN, Tel.: (09861) 92599
    http://wayup.name/GANZ-HEILEN,-Tel-09861-92599
  19. Wayup med. Wellness-Massage
    http://wayup.name/med-Wellness-Massage
  20. Wayup DORN-Seminar
    http://wayup.name/DORN-Seminar
  21. Wayup Kontakt, English, Impressum
    http://wayup.name/Kontakt,-English,-Impressum
  22. Wayup Anreise, (P) Parken
    http://wayup.name/Kontakt,-English,-Impressum/Anreise,-P-Parken
  23. Wayup + english
    http://wayup.name/Kontakt,-English,-Impressum/english
  24. Wayup Termine, treatment appointment
    http://wayup.name/Kontakt,-English,-Impressum/Termine,-treatment-appointment
  25. Wayup NATURHEILKUNDE-NOTDIENST
    http://wayup.name/Kontakt,-English,-Impressum/NATURHEILKUNDE-NOTDIENST
  26. Wayup GUTSCHEIN
    http://wayup.name/Kontakt,-English,-Impressum/GUTSCHEIN
  27. Wayup Dorn-Seminar-Anfrage
    http://wayup.name/Kontakt,-English,-Impressum/Dorn-Seminar-Anfrage
  28. Wayup Gebühren
    http://wayup.name/Kontakt,-English,-Impressum/Gebuehren
  29. Wayup Impressum
    http://wayup.name/Kontakt,-English,-Impressum/Impressum
  30. Wayup Datenschutz
    http://wayup.name/Kontakt,-English,-Impressum/Datenschutz
  31. Wayup + Rothenburg berührt > touches
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches
  32. Wayup Tipps und Empfehlungen
    http://wayup.name/Tipps-und-Empfehlungen
  33. Wayup per E-Mail [email protected]
    http://wayup.name/Kontakt,-English,-Impressum
  34. Wayup E-Mail-Anfrage
    http://wayup.name/Kontakt,-English,-Impressum/Termine,-treatment-appointment
  35. Wayup Hier gibt's Gutscheine
    http://wayup.name/Kontakt,-English,-Impressum/GUTSCHEIN
  36. Wayup Bitte Behandlungstermine immer hier per E-Mail oder telefonisch vereinbaren.
    http://wayup.name/Kontakt,-English,-Impressum/Termine,-treatment-appointment
  37. Wayup Please arrange treatment appointments by e-mail or telephone.
    http://wayup.name/Kontakt,-English,-Impressum/Termine,-treatment-appointment
  38. Wayup IMPRESSUM
    http://wayup.name/Kontakt,-English,-Impressum/Impressum
  39. Wayup DATENSCHUTZ
    http://wayup.name/Kontakt,-English,-Impressum/Datenschutz
  40. http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/AKTUELLES
    http://wayup.name/HEILPRAKTIKER-OLIVER-B-SCHMID/AKTUELLES
  41. Wayup Dorn-Seminar
    http://wayup.name/DORN-Seminar
  42. Wayup wieder regelmäßig. 
    http://wayup.name/DORN-Seminar
  43. Wayup s gibt immer einen Weg
    http://wayup.name/DORN-Seminar
  44. Wayup Behandlungs-Termin und Seminaranmeldung bitte hier
    http://wayup.name/Kontakt,-English,-Impressum/Termine,-treatment-appointment
  45. Wayup vereinbaren oder per Praxis-Telefon: (09861) 92599
    http://wayup.name/Kontakt,-English,-Impressum/Termine,-treatment-appointment
  46. http://wayup.name/;focus=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625&frame=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625
    http://wayup.name/;focus=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625&frame=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625
  47. Wayup Ursachenheilkunde
    http://wayup.name/ALTERNATIVE-MEDIZIN-ORTHOPAeDIE
  48. Wayup AKMON,   BASISBEWEGUNG
    http://wayup.name/DORN-Seminar/DORN-SELBSTHILFE-und-ihre-3-Ebenen-DER-AKMON
  49. Wayup Friede den Eintretenden,   
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches
  50. Wayup Wohlbefinden den Hinausgehenden
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches
  51. Wayup (Segnung an Stadttor)
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches
  52. Wayup  Peace for those who enter,
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches
  53. Wayup  well-being for those who leave.
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches
  54. Wayup (Blessing at a historic city gate of Rothenburg)
    http://wayup.name/Kontakt,-English,-Impressum/Rothenburg-beruehrt-touches

Links - Internal (nofollow)

1:
  1. http://wayup.name/;focus=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625&frame=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625
    http://wayup.name/;focus=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625&frame=TKOMSI_com_cm4all_wdn_social_FacebookPage_22144625

Keyword Cloud for Wayup.name

schmidtreatmentifdiealternative0heilenvarichterminebehandlungenzur verfgung gestelltgehtgestellt werdenpergeradewerdensmsmichknnendernichtgestelltverfgung gestellt werdenzbzuihre17englishauchimmermir17 59zur verfgungbeivon drittanbietern17 59 59hreffunctionverfgung09861drittanbieternvonverfgung gestellt1zurinhaltenutzeraktivitt59 59alternative immuntherapiehiercookiespatientenbemailimmuntherapieum17 17mitganzheitlichesie2kvnacholiver17 17 59slideshowwebseiteposif slideshowmeineroderkeyvisualelementber

Wayup.name Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Wayup-admin.com
Jobs & Internships for College Students and Recent Grads | WayUp
Wayup-agency.com
WAYUP Agency – We Accelerate Your Ultimate Potential !
Wayup-msk.com
Domain has been assigned
Wayup-production.com
WAYUP Agency – We Accelerate Your Ultimate Potential !
Wayup-productions.com
WAYUP Agency – We Accelerate Your Ultimate Potential !
Wayup.com
Jobs & Internships for College Students and Recent Grads | WayUp
Wayup.gg
WayUp.GG - A sua loja de eSports no Brasil!
Wayup.name
Heilpraktiker Oliver Bruno Schmid, Naturheilpraxis, 91541 Rothenburg, Rothenburg ob der Tauber, Hornburgweg 10, Telefon 09861 92599, Chiropraktik, Osteopathie, Schmerztherapie, Dorn, Dieter Dorn, Dorn-Therapie, Dorn-Methode, Dorn-Seminar, Dorn-Schule, Dorn-Lehrer, Dorn-Ausbilder, Dorn-Ausbildung, Dorn-Kurs, Orthopädie, Sportmedizin, Alternative Medizin, Alternative Orthopädie, Homöopathie, Dunkelfeld-Mikroskopie,
Wayup.pl
WayUp | Strona główna

Recently Updated Websites

Rawwaterforsale.com 5 seconds ago.Lichttraum-kiel.com 7 seconds ago.4rstraining.com 7 seconds ago.Cindyssweetshop.biz 10 seconds ago.Koalaboration.com 12 seconds ago.Becomingthemrs.today 17 seconds ago.Smoothiechicken.com 17 seconds ago.Scheirercompanyinc.com 20 seconds ago.Mulundeyecare.com 21 seconds ago.Fine-2013.com 24 seconds ago.Tomlinsonjanitorial.com 26 seconds ago.025zn.com 28 seconds ago.Originallovenote.net 30 seconds ago.Ybvip2436.com 31 seconds ago.Thefamilycodes.com 31 seconds ago.Threadnbobbin.com 34 seconds ago.8161999.com 35 seconds ago.Mycuratedestate.com 36 seconds ago.Jgrx.org 38 seconds ago.Paoloshishido.com 39 seconds ago.Improteine.fr 39 seconds ago.Nashvilleyogafarm.com 41 seconds ago.Becon-public.net 41 seconds ago.Hblingke.com 44 seconds ago.Queritel.net 48 seconds ago.Charlescamsell.com 48 seconds ago.Libscy.com 50 seconds ago.Lakkaripitt.com 50 seconds ago.Pteiran.com 51 seconds ago.Realestateforyouandforme.com 51 seconds ago.