Web.de  |  WEB.DE - E-Mail-Adresse kostenlos, FreeMail, De-Mail & Nachrichten
High trust score  | 
Das beliebteste Internetportal Deutschlands mit Angeboten rund um Suche, Kommunikation, Information und Services.

Web.de Website Information

Website Ranks & Scores for Web.de

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:288
Majestic Rank Majestic Rank:2,484
Domain Authority Domain Authority:87%
DMOZ DMOZ Listing:Yes

Whois information for web.de

Full Whois Lookup for Web.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Web.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html

Domain: web.de
Nserver: ns-webde.ui-dns.biz
Nserver: ns-webde.ui-dns.com
Nserver: ns-webde.ui-dns.de
Nserver: ns-webde.ui-dns.org
Dnskey: 257 3 8 AwEAAcBs30zgmOeYcUYzJetRzRYGQXlnXpv2gO3KWf5BYRn9OqFtUBzFOqO16Ow2XPqR8SWqpAVpnToQICICZyf58SHaefGn94fTj+PlwJi4HhoCbim2U3G5sYtl5xoNfUCaDXDQFJp+HnZlaA9afHutOVFtqCmMHV+2ApSyOFFETQNmq4YoxLxiJoxSjvQAaaiJKVoA4wykjXALMyCmbXGH4aMVbW2m0Fuqe+nKU8myW14nCASBo0mDO6cBNsBwu7IiL4SxxnflDCSTkn/FnCKtzf7aVzzrRM4SqTe4NOm7wPmCZiAGoxOL15PZ7YQSt9BEXU6gMdGxCGVBdtgM13NfziM=
Status: connect
Changed: 2016-04-11T11:09:54+02:00

Name: Hostmaster of the day
Address: Elgendorfer Str. 57
PostalCode: 56410
City: Montabaur
CountryCode: DE
Phone: +49-721-9600
Fax: +49-721-91374-215
Email: Login to show email

Name: Hostmaster of the day
Address: Elgendorfer Str. 57
PostalCode: 56410
City: Montabaur
CountryCode: DE
Phone: +49-721-9600
Fax: +49-721-91374-215
Email: Login to show email

Who hosts Web.de?

Web.de is hosted by 1&1 Internet AG in Hessen, Frankfurt Am Main, Germany, 65931.
Web.de has an IP Address of and a hostname of

Web.de Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:1&1 Internet AG
Hosted Country:GermanyDE
Location Latitude:50.1155
Location Longitude:8.68417
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Web.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 22 May 2015 11:40:01 GMT
Server: Apache
X-Frame-Options: deny
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Pragma: no-cache
Cache-Control: no-cache, no-store, public
Vary: User-Agent,Accept-Encoding
X-Appserver: hp-webde-bs015
Content-Encoding: gzip
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked

Need to find out who hosts Web.de?

Web.de Free SEO Report

Website Inpage Analysis for Web.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Web.de

planscht imampjohann laferzeigtzahl derunicefdemailjessica bielproduktemanjensman den perfektenrohebei dercomicsnoch niezweiman denimtotkannneuertodesopferwologinsprichthomepagegt 67 heritagediesagteum timowebde clubvorteilsweltjohann lafer rastetspielhat sieichdem immobilienmarktnicolainicolai mllerinstagramsie dendeutschlandneuenvideoswo istschnerdoganverzcktkanalvlligvideoum denimmobilienmarktjessicamamadenihren drolligenden perfektenfilmedrohtder starsplanschtesberweltwenndemblstudiezuausdie kleineabjemenihremtotalwernerfansadservicecleanup ifspanienrichtigperfektenlaferwarnensindmit demeinemgegenfrkinderlafer rastet richtigwarenmllertimomussneuepolizistenclubaufhilfephotoshopfailsrastet richtigfrauservicesfindetallesdessehenaltseitenabspielen dasniesetztdieserloskommtzwischenjohannkleinegibtbt man denbeimdiesendiesem fotozahldasmartinalsjahrenklickenseinemwontorraeinereinewo ist derifsucheistwirbleibenbieldochbringtflltfnfist totraebt mandie bestenpostfachwartrkeinicht mehrauchswegengesundheitihr3mehr alsblickbrotherquotsorgt fremailmichmehr webdeevelynaberlebennochweitermachtzumhinweissportmannangebotallegt 67sichernjustineinihreliebewerdendas drohtinsjaschonstarsderfcschwangerwegdonaldverzckt dieummit ihren drolligenihmhinweis aufimmerquicktipppoolsthleadservicecleanupheritageeraktuellezusammensollihrendrolligentdlichemodelvielewochesophiagtnie in derganzhatnichtohnedieselwebdedemmerkelhensslerfr denauf die1 fceigenehummelssiemiovonbig brotherquotmenschenwitzigdas istrastet richtig ausdiesemit denbigaus demeinen1autoswirdhatteamnichtsgehtbrowserabspielensind diedreiist derzurvomgab2weildomainsonnenfinsternismachenwiemitzagatosichdroht dem immobilienmarktrastetgegen denphotoshopfails derweiteresdiesesseinich liebeabsturzsteffenbrauchtihrer67 heritageverletztnewszeigensojetztodernachfreemailhaltenwiederdiesemdicapriopower0photoshopfails der starsserienunfallvorwolfebeiknnenphilippinternettunsorgtsich beimrichtig ausgemachtcholeralottodas droht demunterhabenbestendeutscheonlinestartseitekarikaturenchicagoautos sindgewinnttrumpsgegen dieseitewurdemit einemnunverzckt die kleinedroht demmehrdannnurlafer rastetbtfotomit ihrentimo werner

Longtail Keyword Density for Web.de

lafer rastet richtig5
man den perfekten3
bt man den3
photoshop-fails der stars3
mit ihren drolligen3
gt 67 heritage3
wo ist der3
verzckt die kleine3
droht dem immobilienmarkt3
johann lafer rastet3
rastet richtig aus3
nie in der3
das droht dem3
ist der6
mit einem6
lafer rastet5
rastet richtig5
autos sind5
droht dem5
der stars5
adservicecleanup if4
um timo4
fr den4
auf die4
gegen den4
mehr als4
sorgt fr4
mit dem4
bt man3
man den3
den perfekten3
diesem foto3
ihren drolligen3
mit ihren3
planscht im3
verzckt die3
die kleine3
photoshop-fails der3
zahl der3
webde club3
timo werner3
big brotherquot3
gegen die3
wo ist3
gt 673
67 heritage3
jessica biel3
mehr webde3
das droht3
um den3
das ist3
sie den3
die besten3
bei der3
mit den3
nicht mehr3
abspielen das3
richtig aus3
aus dem3
johann lafer3
sich beim3
noch nie3
sind die3
hinweis auf3
nicolai mller3
dem immobilienmarkt3
ich liebe3
1 fc3
ist tot3
hat sie3

What are the nameservers for web.de?

Web.de Domain Nameserver Information

HostIP AddressCountry
ns-webde.ui-dns.biz Germany
ns-webde.ui-dns.com Germany
ns-webde.ui-dns.de Germany
ns-webde.ui-dns.org Germany

Web.de DNS Record Analysis DNS Lookup

web.deNS40000Target: ns-webde.ui-dns.de
web.deNS40000Target: ns-webde.ui-dns.org
web.deNS40000Target: ns-webde.ui-dns.biz
web.deNS40000Target: ns-webde.ui-dns.com
web.deSOA40000MNAME: ns-webde.ui-dns.de
RNAME: dnsadmin.1und1.de
Serial: 2005094410
Refresh: 28800
Retry: 7200
Expire: 604800
web.deMX900Priority: 100
Target: mx-ha02.web.de
web.deMX900Priority: 100
Target: mx-ha03.web.de
web.deTXT1800TXT: v=spf1 ip4:
ip4: ip4:
ip4: ip4:
web.deTXT40000TXT: google-site-verification=No4jlUg2OIV7IsI

Alexa Traffic Rank for Web.de

Alexa Search Engine Traffic for Web.de