Washington Elementary School District / Homepage

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-12-24

The WESD is an award-winning public school district in Phoenix and Glendale, serving pre-k through eighth grade.


Domain summary

Domain label
wesdschools
Domain extension
org
Domain registered:
2006-05-24
Domain updated:
2020-12-24
Global Traffic Rank
0
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is wesdschools.org ranked relative to other sites:

Percentage of visits to wesdschools.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wesdschools.org registered?
A: Wesdschools.org was registered 14 years, 9 months, 1 week, 5 days, 22 hours, 35 minutes, 41 seconds ago on Wednesday, May 24, 2006.
Q: When was the WHOIS for Wesdschools.org last updated?
A: The WHOIS entry was last updated 2 months, 1 week, 5 days, 22 hours, 35 minutes, 41 seconds ago on Thursday, December 24, 2020.
Q: What are Wesdschools.org's nameservers?
A: DNS for Wesdschools.org is provided by the following nameservers:
  • ns07.domaincontrol.com
  • ns08.domaincontrol.com
Q: Who is the registrar for the Wesdschools.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Wesdschools.org?
A: Wesdschools.org has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Wesdschools.org each day?
A: Wesdschools.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Wesdschools.org resolve to?
A: Wesdschools.org resolves to the IPv4 address 52.206.191.232.
Q: In what country are Wesdschools.org servers located in?
A: Wesdschools.org has servers located in the United States.
Q: What webserver software does Wesdschools.org use?
A: Wesdschools.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Wesdschools.org?
A: Wesdschools.org is hosted by Amazon.com, Inc. in Virginia, Ashburn, United States, 20149.
Q: How much is Wesdschools.org worth?
A: Wesdschools.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Wesdschools.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wesdschools.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wesdschools.org

H1 Headings

34 :
  1. QUICK LINKS
  2. Washington Elementary School District
  3. LATEST NEWS
  4. WESD COVID Updates 2020 - 2021
  5. School Reopening Dashboard and Guidance
  6. Ocotillo Elementary Designated as an A+ School of Excellence™ by the Arizona Educational Foundation
  7. Lookout Mountain School Recognized as Exemplary High Performing National Blue Ribbon School
  8. Two WESD Principals Named Exemplary Principals by Maricopa County
  9. Family Tech Support
  10. Back to School Grab and Go Meal Program
  11. WESD Governing Board Letter of Support
  12. Tumbleweed Elementary Awarded $20,000 Grant from Office Depot
  13. Arizona Cardinals and Desert Financial Donate 33 Laptops to Ironwood Elementary
  14. Educational Resources for Students
  15. School Connect Partnership Donates 130 Laptops to WESD Families
  16. Greater Phoenix Chamber Foundation and Data Doctors donate 100 refurbished laptops
  17. 2020 Lamp of Learning Honorees Announced
  18. HonorHealth and Sprouts Create Outdoor Learning Lab at Desert View
  19. Students Receive Perfect Scores on Both Math and English AzMERIT Test
  20. Congratulations to Jessica Buttles, Kindergarten Teacher at Sunburst Elementary!
  21. WESD’S Assistant Superintendent, Dr. Lyn Bailey, Selected as Public Educator of the Year!
  22. Justin Wing, Director of Human Resources, Receives Administrator of the Year Award
  23. WESD Listed as one of the Top 20 School Districts in the Country for Student Growth
  24. UPCOMING EVENTS
  25. Today
  26. Tomorrow
  27. Friday
  28. Saturday
  29. Sunday
  30. Monday
  31. Tuesday
  32. Shortcuts
  33. WESD Facebook
  34. SPECIAL NOTICES

H2 Headings

2 :
  1. At a Glance
  2. Find Us

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-144990145-1

Links - Internal

171:

Links - Internal (nofollow)

0:

Links - Outbound

20:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wesdschools.org

miid pmi tag1 var renderlocgroupyear groupmonth groupmonthif dialogoverlaywindowlargemodalbodymoderatecontentlengthfindtabindexfirstfocusgroupyear groupmonthtag containersidebar listif trimsublisthtml sublistattrariahiddenvar viewtouse ifhidmiidsidebarlistviewlengthtag enablequirksmode0viewidviewtousewesdpmi renderloc0fromrenderloc0groupyear groupyearinformationlist view definedtag viewtousedialog ifuiswalertlength if swalertopenawardelementary4 var2 chksidebar settimeoutfunctionnoclick else iftargetview container 2documentonmouseoverdocumentreadyfunction varnavsrenderloc0fromrenderloc0groupyearfunction loadtaggeddatacontainer miidgroupyear groupyearetargetblurgostaffendhidemedandlargeremovebrokenimagesetargetblur etargetclasslistremovefocusrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtousemakeenablequirksmode0viewid viewtouse tagepreventdefault close dialogloadgroupeddatacontainer miidelse alertboxid noclickpmi flexdataid groupyeare var swalertopentoolongflexdataid flexdataidgroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tagspecialflexdataid flexdataid groupyearalertboxid noclick elseloaddatacontainer miidgroupbyfield groupbyoklengthpageid 1allulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedthisclick functionifhidmiidsidebarlistviewlength 0success failureclassok or nonoclick else7tag container 2get idtrueattrariaexpanded falseekeycode 13 thisclicktargetview tag iftargetviewdetaildata success failurefamiliesetargetblur etargetclasslistremovefocus documentreadyfunctiongroupby tag viewtouseuiswalert function eactiveselectoridactive classpagemoduleinstanceid pmi renderloc0fromrenderloc0taguidialogoverlay uiswalertfunction loadgroupeddatacontainergroupyeargroupmonth groupby tagifewhich 13 thisclickepreventdefault gettag tagvar renderloc 0activeselectorid aattrtargetschoolswalertopen uiswalertlengthepreventdefaultli akeypressfunctione ifewhichtargetview tagflexdataid groupyearthischildrenul ifgroupmonth groupby targetviewtag viewtouse looksgroupby taguiswalert functionthischildrenul if trimsublisthtmlnavigationlookout mountain schoolcontent doesnt bleedtag viewidsublist thischildrenul ifrenderloc0fromrenderloc0tagpressed on datepickermountainuiswalertlength ifhidmiiddetailviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidif raisedbydatepicker estopimmediatepropagationpagenavigationstatecookie functionraisedbydatepicker estopimmediatepropagationkey estopimmediatepropagation epreventdefaultsublist thischildrenulactiveopenestopimmediatepropagation if ekeycodedata varif trimsublisthtmlfoundationgroupby targetviewthisremoveclasshover var sublistsitenavulheightcongratulationsviewidgroupbyfield groupby enablequirksmode0viewidoklength 0trueattrariaexpanded0 varbleedreceivedvar pageidsuredoesnt bleed27 escapeepreventdefault checkenablequirksmode0viewidpwidthloadgroupeddatacontainervar sublist thischildrenulsidebarlistviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidsublistattrariahiddenakeypressfunctione ifewhich 13bodyonkeydowntag enablequirksmode0viewidviewtouse containeronlineaddoffcanvasmenuheightforsitenavresourcesviewtouse tag tagthisclick function loadgroupeddatacontainerloadtaggeddatacontainer miid pmialertboxidviewtouse hid miidakeydownfunction e estopimmediatepropagationiftargetviewcontainertagdataepreventdefault closecontentview var viewtouseifgroupbyfielddomainid 4closemodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp0 viewtouse hidviewtouse ifhidmiidsidebarlistviewlengthgetcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceidflexdataid groupyear groupmonthcheckschools commentsfailureadded to checkcheck if escvar viewtousecheck ifrenderloc0fromrenderloc0groupyear groupyear groupmonthif ekeycode 13alertboxid okclickfailure callcontrollerfailureresult0errormessageokclickstudentshid miidviewtousegroupby renderloc0fromrenderloc0enablequirksmode0tag tagcheckscriptmoduleviewcheckscriptmustache4 var pageidgroupby enablequirksmode0viewidhidden detail view8miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustacheelserenderloc 0tag iftargetviewtaglist licovidescape key estopimmediatepropagationgroupmonth groupbyfieldbuilder viewuidialogoverlaybasemodalclickiddivswspecialmodebarswalertopen uiswalertlength ifepreventdefault get idlookouttag tag container2 chksidebar functionrenderloc0fromrenderloc0tag tagpressedview targetview hidmiiddetailviewvalelse if ekeycodeuidialogoverlay uiswalert functionpmi flexdataidview vargroupmonth groupbyfield groupbypmi tag viewtousehelprenderloc0fromrenderloc0enablequirksmode0tag tag viewidmoderated content doesntetargetclasslistcontainsdatepicker if raisedbydatepickervar domainidfunction loadtaggeddatacontainer9if alertboxid oklengthtrueselectedselectschoolulheightexcellencevargroupby renderloc0fromrenderloc0enablequirksmode0taguiswalertattrid click okmodulecontent miid findtabindexfirstfocusif alertboxidheighttheirtag viewid targetviewekeycode 13pmialert varvar pageid 1taglistelearningetargetclasslistremovefocus documentreadyfunctionpmi groupyear groupmonthestopimmediatepropagationestopimmediatepropagation epreventdefault closeiseditsubundefined targetviewlengthdata successclose dialogbuttonproplinkhref1 if ekeycodeoksublistattrariahidden trueattrariaexpanded falselidatabcsid activeselectoridtargetviewlengthif ekeycodewinterkeydatepicker var raisedbydatepickerescapemoderatedmiid pmi flexdataidbuilder view varhrefalertboxid oklength 0dialogoverlaywindowlargemodalbodymoderatecontentlength 0hidmiiddetailviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidactivechannelnavtypemiid pmi groupyearexemplaryloaddatacontainer miid pmielse remove focuschksidebarthisclickuiswalertattrid clickestopimmediatepropagation ifpagemoduleinstanceid pmipagemoduleinstanceid pmi renderloc0fromrenderloc0groupyearakeydownfunction e13 thisclick functionvar swalertopenheretargetviewlength 0 targetviewcheck to makeloadgroupeddatacontainer miid pmi0findtrimsublisthtml sublistattrariahiddenrenderloc0fromrenderloc0groupyear groupyeariftargetview undefined targetviewlengthuidialogoverlaybasemodal uidialogoverlayescteachercontent doesnthidmiiddetailviewvalsitecomments 1alertboxid uiswalertattrid clickuluibreadcrumbsmiid pmi0 alertboxid okclicksure moderated contenttargetviewlength 0pageifhidmiidsidebarlistviewlength 0 viewtouselisuccessif raisedbydatepickerdetail view definedeventpmi flexdataid flexdataidviewid targetviewloadtaggeddatacontainer miiddocumentreadyfunction taglist libleed throughswalertopen 1 ifmiid sidebarlistviewvalenablequirksmode0viewidviewtouse container 2var renderloctargetview hidmiiddetailviewvalekeycode 27if dialogoverlaywindowlargemodalbodymoderatecontentlength 0akeypressfunctione ifewhichalreadyraisedbydatepickeralert var alertboxiddocumentonmouseoutsupportmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionremove focus etargetblurdatepickerdialogoverlaywindowlargemodalbodymoderatecontentlengthremove focusfunction1 vargetcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid0 alertboxidhid miid sidebarlistviewvalmodulecontent miidviewakeydownfunctionoklength 0 alertboxid0 var miid4windowlocationestopimmediatepropagation epreventdefault checkdialoghiddenopen alert varsidebar list viewsidebarlistviewvalchksidebar function loaddatacontaineruiswalertattridlookout mountaindocumentreadyfunction var domainidrenderloc0fromrenderloc0enablequirksmode0tagbodyonkeydown uidialogoverlaybasemodal uidialogoverlayalertboxid oklengthacademicsettimeoutfunctiondomainiduidialogoverlayclosemodalvisiblelastclick2throughhidchildrensublistattrariahidden trueattrariaexpandedenablequirksmode0viewidviewtouseif ekeycode 27calendaruidialogoverlay5defined2 chksidebarfunction e varmiid pagemoduleinstanceidlookssure moderatedsettimeoutfunction modulecontentmiid findtabindexfirstfocustargetview looksswchanneldropdownhide thisremoveclasshoveretargetclasslistcontainsdatepickerchksidebar settimeoutfunction modulecontentprincipalsarizonavar miid0 viewtousedocumentreadyfunction taglistdialog uidialogoverlayclosemodalvisiblelastclick elseescape keyuidialogoverlayclosemodalvisiblelastclick else removeeducationaluserregidepreventdefault check ifnavchksidebar settimeoutfunctiongroupmonth groupbypageid 1 vartaglist li akeypressfunctione3setviewtouse ifhidmiidsidebarlistviewlength 0swchanneldropdownhide thisremoveclasshover varfalseelse ifenablequirksmode0viewid viewtousevar failuree estopimmediatepropagation if1groupmonth groupmonth groupbyfieldmiid sidebarlistviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidmoderated contentif swalertopenviewid targetview containertrimsublisthtml sublistattrariahidden trueattrariaexpandedgetcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidpmi groupyearaattrhrefpageidiftargetview undefined0 targetviewraisedbydatepicker etargetclasslistcontainsdatepicker ifdetail viewswchanneldropdownhidevar domainid 4activeselectorid aattrhrefchksidebar function loadtaggeddatacontainerpagenavigationstatecookieokclick else alertboxidaddeddesert13 thisclickif escfunction loaddatacontainer miidarizona educationalfindtabindexfirstfocus 2000 modulecontentflexdataidvar swalertopen uiswalertlengthmodulecontentgroupmonth groupmonthdata var successtag iftargetview undefinedtargetviewchannelviewtouse looksdoesnt bleed through27 escape keychevronthischildrenul10make sure moderatedvar sublistnavs activeselectoridraisedbydatepicker etargetclasslistcontainsdatepickerfocus etargetblurid of openif eventkeycodepagemoduleinstanceid pmi flexdataidalertfocustargetview containerflexdataid groupyear groupyearekeycode 27 escapeview definedcallcontrollerfailureresult0errormessagefunction ifmiid pagemoduleinstanceid pmi1 ifyearpmi tagelse removeclick oksidebargroupbypmi renderloc0fromrenderloc0groupyearmenubodyonkeydown uidialogoverlaybasemodalopenpagesubmenuthisparentetargetclasslistcontainsdatepicker ifthrough the dialogfunction loadgroupeddatacontainer miidhidden sidebarmiidno ifno if alertboxidviewtouse tagdialog if dialogoverlaywindowlargemodalbodymoderatecontentlengthsublistlist viewundefined targetviewlength 0zindexaddcommunityvar failure callcontrollerfailureresult0errormessagepmi renderloc0fromrenderloc0tag tagthisremoveclasshover varwinter breakvar alertboxid uiswalertattridrenderloc 0 varetargetclasslistremovefocus0 targetview looksmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionli akeypressfunctionebuilder view targetviewvar alertboxidestopimmediatepropagation epreventdefault getlicollapsibleeachfunctionschoolsdocumentreadyfunction checkscriptmoduleviewcheckscriptmustachesettimeoutfunction modulecontent miidgroupyear groupmonth groupbyifhidmiidsidebarlistviewlengthgroupby enablequirksmode0viewid viewtousealertboxid noclickpmi renderloc0fromrenderloc0tag6enablequirksmode0viewidviewtouse containerhidden sidebar list0 if0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbsppagemoduleinstanceidstrcookievar raisedbydatepickerchksidebar functionkey estopimmediatepropagationelse alertboxidreceivesswalertopenmake suree estopimmediatepropagationuidialogoverlaybasemodal uidialogoverlay uiswalertcontainer 2 chksidebartrimsublisthtmlclose dialog uidialogoverlayclosemodalvisiblelastclicklaptopsokclick elseestopimmediatepropagation epreventdefaultakeypressfunctioneourvar datamountain schoolviewtouse hidhidden detailuidialogoverlayclosemodalvisiblelastclick elseloadtaggeddatacontainerview targetviewalertboxid okclick elsegetvar raisedbydatepicker etargetclasslistcontainsdatepickeropen alertlistfunction eremovebreakekeycodeif swalertopen 1groupby targetview taghidelargeraisedbydatepicker estopimmediatepropagation epreventdefaultifewhichfunction loaddatacontainertargetview hidmiiddetailviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidaattrtargetloaddatacontainersectiondocumentonclickrenderloc0fromrenderloc0enablequirksmode0tag tagcommentsvar successesc was pressedswinnerwrapheightdialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontentmiid findtabindexfirstfocus 200renderlocdatepicker varnothisremoveclasshoverhomeswalertopen 1uiswalertlengthlidatabcsidalertboxid uiswalertattridbuilderuiswalertparentzindexsidebarlistviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidmiidfinduiwidgetdetailfinduiarticleappendnbspgroupmonthaeachfunctionifewhich 13var data vareventdateiddoesntcontainer 2documentreadyfunctiondialog uidialogoverlayclosemodalvisiblelastclicknoclickundefinedswgotosearchresultspageswsearchinputeventkeycodedomainid 4 varschools comments 1focus etargetblur etargetclasslistremovefocusgroupyear groupyear groupmonthe var

Longtail Keyword Density for Wesdschools.org

KeywordsOccurences
if ekeycode 2720
ekeycode 27 escape20
27 escape key20
escape key estopimmediatepropagation20
key estopimmediatepropagation epreventdefault20
container 2 chksidebar12
getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceid12
miid pagemoduleinstanceid pmi12
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
id of open10
ok or no10
ui-sw-alert function e10
function e var10
e var swalertopen10
var swalertopen ui-sw-alertlength10
ui-sw-alertattrid click ok10
alertboxid ui-sw-alertattrid click10
var alertboxid ui-sw-alertattrid10
alert var alertboxid10
open alert var10
epreventdefault get id10
if alertboxid oklength10
estopimmediatepropagation epreventdefault get10
else remove focus10
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
remove focus etargetblur10
swalertopen ui-sw-alertlength if10
focus etargetblur etargetclasslistremovefocus10
ui-sw-alertlength if swalertopen10
if swalertopen 110
swalertopen 1 if10
1 if ekeycode10
no if alertboxid10
alertboxid oklength 010
epreventdefault close dialog10
pressed on datepicker10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
ui-dialog-overlay ui-sw-alert function10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
estopimmediatepropagation epreventdefault close10
raisedbydatepicker estopimmediatepropagation epreventdefault10
if raisedbydatepicker estopimmediatepropagation10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
datepicker var raisedbydatepicker10
esc was pressed10
oklength 0 alertboxid10
check if esc10
epreventdefault check if10
estopimmediatepropagation epreventdefault check10
else if ekeycode10
noclick else if10
alertboxid noclick else10
else alertboxid noclick10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
alertboxid okclick else10
0 alertboxid okclick10
okclick else alertboxid10
etargetblur etargetclasslistremovefocus documentreadyfunction9
view var viewtouse8
sidebar list view8
if ekeycode 138
var viewtouse ifhid-miid-sidebarlistviewlength8
groupyear groupmonth groupby8
groupmonth groupbyfield groupby8
groupmonth groupmonth groupbyfield8
groupyear groupmonth groupmonth8
tag viewtouse looks8
hidden sidebar list8
2 chksidebar function8
list view defined8
ifhid-miid-sidebarlistviewlength 0 viewtouse8
-sidebarlistviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid8
miid -sidebarlistviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid8
hid- miid -sidebarlistviewval8
viewtouse hid- miid8
builder view var8
0 viewtouse hid-8
viewtouse ifhid-miid-sidebarlistviewlength 08
ekeycode 13 thisclick6
estopimmediatepropagation if ekeycode6
e estopimmediatepropagation if6
if trimsublisthtml sublistattraria-hidden5
sublistattraria-hidden trueattraria-expanded false5
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
akeydownfunction e estopimmediatepropagation5
pmi tag viewtouse4
tag viewid targetview4
renderloc0fromrenderloc0enablequirksmode0tag tag viewid4
viewid targetview container4
targetview container 24
chksidebar function loadtaggeddatacontainer4
function loadtaggeddatacontainer miid4
loadtaggeddatacontainer miid pmi4
miid pmi tag4
module-content- miid findtabindexfirstfocus4
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag4
pmi renderloc0fromrenderloc0tag tag4
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse4
tag enablequirksmode0viewidviewtouse container4
enablequirksmode0viewidviewtouse container 24
2 chksidebar settimeoutfunction4
chksidebar settimeoutfunction module-content-4
settimeoutfunction module-content- miid4
miid findtabindexfirstfocus 2004
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag4
groupby renderloc0fromrenderloc0enablequirksmode0tag tag4
iftargetview undefined targetviewlength4
groupyear groupyear groupmonth4
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache4
through the dialog4
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength4
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 04
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-4
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp4
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction4
documentreadyfunction tag-list li4
content doesnt bleed4
tag-list li akeypressfunctione4
li akeypressfunctione ifewhich4
akeypressfunctione ifewhich 134
ifewhich 13 thisclick4
13 thisclick function4
thisclick function loadgroupeddatacontainer4
function loadgroupeddatacontainer miid4
doesnt bleed through4
moderated content doesnt4
miid pmi groupyear4
var pageid 14
var sublist thischildrenul4
sublist thischildrenul if4
thischildrenul if trimsublisthtml4
documentreadyfunction var domainid4
var domainid 44
domainid 4 var4
4 var pageid4
pageid 1 var4
sure moderated content4
1 var renderloc4
var renderloc 04
renderloc 0 var4
0 var miid4
added to check4
check to make4
make sure moderated4
flexdataid groupyear groupyear4
loadgroupeddatacontainer miid pmi4
pmi groupyear groupmonth4
hidden detail view4
groupmonth groupby tag4
targetview tag iftargetview4
tag iftargetview undefined4
undefined targetviewlength 04
targetviewlength 0 targetview4
0 targetview looks4
detail view defined4
flexdataid groupyear groupmonth4
builder view targetview4
view targetview hid-miid-detailviewval4
targetview hid-miid-detailviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid4
hid-miid-detailviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid4
pagemoduleinstanceid pmi flexdataid4
pmi flexdataid flexdataid4
flexdataid flexdataid groupyear4
groupmonth groupby targetview4
groupby targetview tag4
pmi flexdataid groupyear4
viewtouse tag tag4
groupby tag viewtouse4
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear4
pmi renderloc0fromrenderloc0groupyear groupyear4
renderloc0fromrenderloc0groupyear groupyear groupmonth4
groupbyfield groupby enablequirksmode0viewid4
groupby enablequirksmode0viewid viewtouse4
miid pmi flexdataid4
enablequirksmode0viewid viewtouse tag4
tag tag container4
tag container 24
chksidebar function loaddatacontainer4
function loaddatacontainer miid4
loaddatacontainer miid pmi4
data var success3
thisremoveclasshover var sublist3
sw-channel-dropdownhide thisremoveclasshover var3
schools comments -13
lookout mountain school3
data success failure3
var failure callcontrollerfailureresult0errormessage3
var data var3
estopimmediatepropagation epreventdefault30
if ekeycode29
comments -122
27 escape20
key estopimmediatepropagation20
escape key20
ekeycode 2720
groupyear groupmonth16
else if15
miid pmi12
view defined12
container 212
builder view12
pagemoduleinstanceid pmi12
miid pagemoduleinstanceid12
getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid12
2 chksidebar12
1 if11
function e11
click ok10
var swalertopen10
no if10
swalertopen ui-sw-alertlength10
13 thisclick10
ui-sw-alertlength if10
if alertboxid10
epreventdefault get10
ui-sw-alertattrid click10
alertboxid ui-sw-alertattrid10
var alertboxid10
alert var10
open alert10
get id10
oklength 010
if swalertopen10
swalertopen 110
alertboxid oklength10
alertboxid okclick10
0 alertboxid10
epreventdefault close10
etargetblur etargetclasslistremovefocus10
focus etargetblur10
bodyonkeydown ui-dialog-overlay-base-modal10
ui-dialog-overlay-base-modal ui-dialog-overlay10
ui-dialog-overlay ui-sw-alert10
remove focus10
else remove10
ui-dialog-overlay-closemodalvisiblelastclick else10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
ui-sw-alert function10
close dialog10
e var10
raisedbydatepicker estopimmediatepropagation10
alertboxid noclick10
etargetclasslistcontainsdatepicker if10
raisedbydatepicker etargetclasslistcontainsdatepicker10
var raisedbydatepicker10
datepicker var10
if esc10
check if10
if raisedbydatepicker10
okclick else10
else alertboxid10
epreventdefault check10
noclick else10
etargetclasslistremovefocus documentreadyfunction9
-sidebarlistviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid8
winter break8
groupbyfield groupby8
groupmonth groupmonth8
groupmonth groupbyfield8
pmi flexdataid8
hid- miid8
chksidebar function8
miid -sidebarlistviewval8
flexdataid groupyear8
viewtouse hid-8
hidden sidebar8
ekeycode 138
groupmonth groupby8
tag viewtouse8
0 viewtouse8
viewtouse looks8
sidebar list8
list view8
view var8
var viewtouse8
viewtouse ifhid-miid-sidebarlistviewlength8
ifhid-miid-sidebarlistviewlength 08
estopimmediatepropagation if6
e estopimmediatepropagation6
var sublist6
if trimsublisthtml6
0 var5
trimsublisthtml sublistattraria-hidden5
sublistattraria-hidden trueattraria-expanded5
if eventkeycode5
documentreadyfunction var5
akeydownfunction e5
trueattraria-expanded false5
chksidebar settimeoutfunction4
loadtaggeddatacontainer miid4
pmi tag4
pmi renderloc0fromrenderloc0tag4
renderloc0fromrenderloc0tag tag4
tag enablequirksmode0viewidviewtouse4
enablequirksmode0viewidviewtouse container4
miid findtabindexfirstfocus4
settimeoutfunction module-content-4
module-content- miid4
findtabindexfirstfocus 2004
lookout mountain4
activeselectorid aattrhref4
function if4
targetview container4
function loadtaggeddatacontainer4
0 if4
viewid targetview4
doesnt bleed4
thisclick function4
ifewhich 134
akeypressfunctione ifewhich4
tag viewid4
tag-list li4
documentreadyfunction tag-list4
documentreadyfunction checkscriptmoduleviewcheckscriptmustache4
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction4
module-content- miidfindui-widget-detailfindui-articleappendnbsp4
0 module-content-4
dialog-overlay-windowlargemodal-bodymoderatecontentlength 04
if dialog-overlay-windowlargemodal-bodymoderatecontentlength4
dialog if4
bleed through4
content doesnt4
loadgroupeddatacontainer miid4
moderated content4
sure moderated4
make sure4
var miid4
renderloc 04
var renderloc4
1 var4
pageid 14
var pageid4
4 var4
domainid 44
var domainid4
thischildrenul if4
sublist thischildrenul4
function loadgroupeddatacontainer4
li akeypressfunctione4
pmi groupyear4
iftargetview undefined4
renderloc0fromrenderloc0enablequirksmode0tag tag4
groupby renderloc0fromrenderloc0enablequirksmode0tag4
groupyear groupyear4
flexdataid flexdataid4
hid-miid-detailviewval getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid4
targetview hid-miid-detailviewval4
view targetview4
detail view4
hidden detail4
groupby tag4
0 targetview4
targetviewlength 04
undefined targetviewlength4
targetview looks4
tag tag4
tag iftargetview4
pmi renderloc0fromrenderloc0groupyear4
targetview tag4
groupby targetview4
renderloc0fromrenderloc0groupyear groupyear4
loaddatacontainer miid4
function loaddatacontainer4
tag container4
viewtouse tag4
enablequirksmode0viewid viewtouse4
groupby enablequirksmode0viewid4
var success3
lidata-bcsid activeselectorid3
arizona educational3
var failure3
navs- activeselectorid3
activeselectorid aattrtarget3
pagenavigationstatecookie function3
active class3
thisremoveclasshover var3
failure callcontrollerfailureresult0errormessage3
data success3
success failure3
sw-channel-dropdownhide thisremoveclasshover3
data var3
schools comments3
mountain school3
var data3
if135
var90
function64
047
else42
miid40
alertboxid40
estopimmediatepropagation36
documentreadyfunction30
epreventdefault30
ekeycode29
tag28
viewtouse28
view27
124
pmi24
groupmonth24
comments22
221
swalertopen20
escape20
raisedbydatepicker20
key20
groupyear20
e18
school18
open17
316
targetview16
check16
groupby16
415
dialog14
close14
wesd14
set14
click13
activeselectorid13
flexdataid12
no12
hidden12
chksidebar12
defined12
elementary12
builder12
getcontenthttpswwwwesdschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid12
pagemoduleinstanceid12
looks12
512
container12
remove12
documentonclick11
esc11
li11
navigation10
etargetclasslistremovefocus10
etargetblur10
focus10
ui-dialog-overlay-closemodalvisiblelastclick10
etargetclasslistcontainsdatepicker10
datepicker10
alert10
thisclick10
pressed10
noclick10
students10
id10
ui-sw-alertattrid10
oklength10
ui-dialog-overlay-base-modal10
get10
false10
bodyonkeydown10
ui-dialog-overlay10
ui-sw-alertlength10
okclick10
ui-sw-alert10
ok10
list9
undefined9
page8
sidebar8
learning8
-sidebarlistviewval8
break8
winter8
hid-8
ifhid-miid-sidebarlistviewlength8
module-content-8
groupbyfield8
data7
success7
support7
eventkeycode7
staff6
trimsublisthtml6
swinnerwrapheight6
arizona6
66
sublist6
href6
failure6
channel6
active6
sublistattraria-hidden6
selected5
award5
userregid5
isedit5
educational5
content5
trueattraria-expanded5
sw-channel-dropdownhide5
through5
akeydownfunction5
true5
make5
home5
sure5
renderloc0fromrenderloc0groupyear4
added4
teacher4
doesnt4
laptops4
pageid4
bleed4
community4
congratulations4
dialog-overlay-windowlargemodal-bodymoderatecontentlength4
renderloc4
enablequirksmode0viewid4
domainid4
section4
documentonmouseover4
74
pagenavigationstatecookie4
navs-4
aattrhref4
windowlocation4
class4
resources4
sub4
our4
menu4
thischildrenul4
thisremoveclasshover4
schools4
year4
moderated4
documentonmouseout4
findtabindexfirstfocus4
tag-list4
84
ifewhich4
akeypressfunctione4
iftargetview4
targetviewlength4
94
settimeoutfunction4
lookout4
enablequirksmode0viewidviewtouse4
renderloc0fromrenderloc0tag4
miidfindui-widget-detailfindui-articleappendnbsp4
detail4
hid-miid-detailviewval4
renderloc0fromrenderloc0enablequirksmode0tag4
loadtaggeddatacontainer4
exemplary4
principals4
mountain4
pwidth4
checkscriptmoduleviewcheckscriptmustache4
loadgroupeddatacontainer4
here4
viewid4
toolong4
loaddatacontainer4
lidata-bcsid3
nav3
special3
chevron3
ului-breadcrumbs3
openpagesubmenuthisparent3
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
selectschoolulheight3
swgotosearchresultspageswsearchinput3
divsw-special-mode-bar3
strcookie3
sitenavulheight3
addoffcanvasmenuheightforsitenav3
aattrtarget3
end3
callcontrollerfailureresult0errormessage3
activechannelnavtype3
eventdateid3
height3
help3
licollapsibleeachfunction3
find3
foundation3
their3
academic3
information3
hidelarge3
all3
children3
families3
hidemedandlarge3
desert3
receives3
received3
removebrokenimages3
site3
excellence3
covid3
online3
calendar3
103
aeachfunction3
event3
parentzindex3
go3
buttonproplinkhref3
already3
add3
zindex3

Who hosts Wesdschools.org?

Wesdschools.org Hosting Provider Information

Hosted IP Address:52.206.191.232
Hosted Hostname:ec2-52-206-191-232.compute-1.amazonaws.com
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:Microsoft-IIS/8.5

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%

HTTP Header Analysis for Wesdschools.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 24 Dec 2020 03:28:39 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: private
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
Strict-Transport-Security: max-age=31536000; includeSubDomains;
X-XSS-Protection: 1; mode=block
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Content-Security-Policy: frame-ancestors 'self' https://*.ally.ac;
X-Frame-Options: SAMEORIGIN

Wesdschools.org Domain Nameserver Information

HostIP AddressCountry
ns07.domaincontrol.com 97.74.103.4
ns08.domaincontrol.com 173.201.71.4


Need to find out who hosts Wesdschools.org?


Domain Registration (WhoIs) information for Wesdschools.org

 Domain Name: WESDSCHOOLS.ORG
Registry Domain ID: D123068386-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2017-05-12T14:38:45Z
Creation Date: 2006-05-24T22:48:43Z
Registry Expiry Date: 2021-05-24T22:48:43Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Washington Elementary School District
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS07.DOMAINCONTROL.COM
Name Server: NS08.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-12-24T03:27:39Z

Websites with Similar Names

Wesdschools.org
Washington Elementary School District / Homepage

Recently Updated Websites

Excellingfromhome.com (1 second ago.)Truvitrin.xyz (2 seconds ago.)Eliteconstructionroofing.com (2 seconds ago.)Cateringaurreraxperience.com (2 seconds ago.)Thebendyboys.com (3 seconds ago.)Roomgenerator.com (3 seconds ago.)Portklin.com (3 seconds ago.)Dewberry.com (3 seconds ago.)Kogiot.gr (4 seconds ago.)Hmrproducer.com (4 seconds ago.)Fjzpn.buzz (4 seconds ago.)Piratemotorsports.com (4 seconds ago.)Ammonitum.com (4 seconds ago.)Jouez-au-poker.com (4 seconds ago.)Dechazal.org (5 seconds ago.)Vidavictoriosaags.com (6 seconds ago.)Amatco.ir (6 seconds ago.)Foodhallguide.com (6 seconds ago.)Predimarvao.pt (6 seconds ago.)Nmp86.com (6 seconds ago.)Applesite.ru (6 seconds ago.)Meatarmy.com (7 seconds ago.)Registersheild.net (7 seconds ago.)Wulf.email (7 seconds ago.)Toledo-theater.com (7 seconds ago.)Animit.expert (8 seconds ago.)Nisekosignatureclub.com (8 seconds ago.)Altbaba.com (8 seconds ago.)Teresamichieli.com (8 seconds ago.)Ateliersdutigre.com (9 seconds ago.)

Recently Searched Keywords

miss777 (1 second ago.)nanny work agreement (3 seconds ago.)dreaft (4 seconds ago.)usshareabout (4 seconds ago.)galliard dubai (5 seconds ago.)zrzky (11 seconds ago.)modimmodim basic (12 seconds ago.)shafeek kabeer (12 seconds ago.)adhesion meaning (12 seconds ago.)centimeter to millimeter (13 seconds ago.)tác dụng tuyệt vời của tổ yến loại 1 mang lại sức khỏe – chia sẻ từ yến sào việt phúc (14 seconds ago.)centimeter to meter (15 seconds ago.)teen (10) (16 seconds ago.)rcs (16 seconds ago.)oil hemp hookah (18 seconds ago.)carly hunter unlv (18 seconds ago.)mỹ trung (19 seconds ago.)livejournalparentid0keywordsnamemenugenitive title (20 seconds ago.)sim du lịch mỹ (21 seconds ago.)8520258 (23 seconds ago.)nfl (24 seconds ago.)выбор кузова автомобиля (25 seconds ago.)python ile programlama dünyasına giriş (26 seconds ago.)article test for class 3 (28 seconds ago.)ui-button-textpadding (29 seconds ago.)plata de ley (30 seconds ago.)else if action (32 seconds ago.)raison (33 seconds ago.)lagos airbnb (33 seconds ago.)immigration0 (34 seconds ago.)