Westfalia-versand.ch  |  Westfalia Versand Schweiz
Low trust score  | 
Westfalia Versand - der Shop für Werkzeuge, Elektronik und viele weitere Produkte mit einem gut sortierten Artikelangebot.

Westfalia-versand.ch Website Information

Westfalia-versand.ch has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 272,165, a Majestic Rank of 0, a Domain Authority of 36% and is not listed in DMOZ.

Westfalia-versand.ch is hosted by Level 3 Communications, Inc. in England, London, United Kingdom, Wc2n 5r.
Westfalia-versand.ch has an IP Address of 195.122.145.60 and a hostname of 195.122.145.60.

The domain westfalia-versand.ch was registered 201 decades 8 years 9 months ago by SWITCH Domain Name Registration, it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for westfalia-versand.ch

Full Whois Lookup for Westfalia-versand.ch Whois Lookup

The number of requests per client per time interval is
restricted. You have exceeded this limit.
Please wait a moment and try again.

Who hosts Westfalia-versand.ch?

Westfalia-versand.ch Web Server Information

Hosted IP Address:195.122.145.60
Hosted Hostname:195.122.145.60
Service Provider:Level 3 Communications, Inc.
Hosted Country:United KingdomGB
Location Latitude:51.5085
Location Longitude:-0.12574
Webserver Software:Not Applicable

HTTP Header Analysis for Westfalia-versand.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 29 Aug 2015 15:08:42 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 15546
Content-Type: text/html


Need to find out who hosts Westfalia-versand.ch?

Westfalia-versand.ch Free SEO Report

Website Inpage Analysis for Westfalia-versand.ch

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Westfalia-versand.ch

alle5sofort490nbspchfnbsp 780nbspchf sofort3sofort lieferbar westfalia2produktvergleich nbsp3990nbspchfsofortsolarproduktvergleich nbspedelstahlmitweitere490nbspchf sofortzum produktvergleich nbspgarantiewestfalialieferbar5cm34 4 139ratschenzum produktvergleich sienurvergleichenlieferbaresotec solar80 00m0 341290nbspchfwestfaliazurrgurt780nbspchf sofortzur490nbspchf sofort lieferbarweitere angebotevergleichen zum produktvergleich00041 0 34zum produktvergleichwattvergleichenstattfrproduktvergleich sie13 80 00zurrmuldeverschiedenenproduktvergleichlieferbar5 jahre garantiewestfalialieferbarweteluxnbsp3990nbspchfsofort780nbspchflieferbargartenmeisterliionproduktvergleich abnbspzum produktvergleich abnbspset0 34 4akku13 80infowestfaliaversandchlieferbarwestfaliaproduktvergleich nbsp 780nbspchfnbspangebotevlieferbar3990nbspchfsetvergleichenzumimabnbsp4 13sofort lieferbarwattvergleichen zum produktvergleich41 078lieferbar5 jahrevergleichen zumxlieferbaresotecled780nbspchf sofort lieferbarzum produktvergleich nbsp3990nbspchfsofort34 44 13 80schweizmmwattvergleichen zumjahrev liion4jahre garantiewestfaliasetvergleichen zum produktvergleich6verschiedenestcknbsp 780nbspchf1sielieferbar westfaliaaussetvergleichen zum

Longtail Keyword Density for Westfalia-versand.ch

KeywordsOccurences
vergleichen zum produktvergleich28
zum produktvergleich sie21
zum produktvergleich nbsp21
sofort lieferbar westfalia6
4 13 805
zum produktvergleich abnbsp5
wattvergleichen zum produktvergleich4
41 0 343
780nbspchf sofort lieferbar3
0 34 43
34 4 133
nbsp 780nbspchf sofort3
490nbspchf sofort lieferbar3
13 80 003
zum produktvergleich nbsp3990nbspchfsofort3
lieferbar5 jahre garantiewestfalia3
setvergleichen zum produktvergleich3
produktvergleich nbsp 780nbspchf3
zum produktvergleich75
sofort lieferbar29
vergleichen zum28
produktvergleich nbsp21
produktvergleich sie21
lieferbar westfalia6
produktvergleich abnbsp5
13 805
4 135
lieferbaresotec solar4
wattvergleichen zum4
weitere angebote4
nbsp 780nbspchf3
780nbspchf sofort3
0 343
41 03
490nbspchf sofort3
34 43
setvergleichen zum3
80 003
lieferbar5 jahre3
jahre garantiewestfalia3
produktvergleich nbsp3990nbspchfsofort3
v li-ion3
zum75
produktvergleich75
lieferbar39
sofort32
vergleichen28
nbsp21
sie21
westfalia13
mit13
solar11
set10
010
lieferbarwestfalia9
cm8
aus7
x7
16
akku6
fr6
25
m5
im5
35
abnbsp5
angebote5
45
led4
zur4
zurrgurt4
zurrmulde4
lieferbaresotec4
weitere4
v4
wattvergleichen4
nur4
statt4
verschiedene4
li-ion4
ratschen3
490nbspchf3
verschiedenen3
1290nbspchf3
stck3
780nbspchf3
53
63
73
schweiz3
edelstahl3
003
nbsp3990nbspchfsofort3
alle3
3990nbspchf3
lieferbargartenmeister3
83
garantiewestfalia3
mm3
93
lieferbarwetelux3
lieferbar53
setvergleichen3
jahre3
infowestfalia-versandch3

What are the nameservers for westfalia-versand.ch?

Westfalia-versand.ch Domain Nameserver Information

HostIP AddressCountry
dns1.web-factory.de 195.122.144.144Germany Germany
ns3.klute-thiemann.de 81.92.4.138Germany Germany
ns4.klute-thiemann.de 81.169.185.119Germany Germany

Westfalia-versand.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Westfalia-versand.ch is a scam?