Wetrecht.nl Favicon Wetrecht.nl

Wetrecht.nl Website Thumbnail
Checking...
Wet & Recht
Low trust score
 | 
Add a review Change category Claim this site
Wij helpen u graag met uw juridisch probleem, van ondernemingsrecht tot contractenrecht tot arbeidsrecht.


Domain summary

Domain label
wetrecht
Domain extension
nl
Global Traffic Rank
573,418
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,400
Estimated daily income
$10
Estimated monthly income
$304

Rank summary

How is wetrecht.nl ranked relative to other sites:

Percentage of visits to wetrecht.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wetrecht.nl registered?
A: Wetrecht.nl was registered 3 weeks, 1 day, 11 hours, 29 minutes, 53 seconds ago on Wednesday, September 9, 2020.
Q: When was the WHOIS for Wetrecht.nl last updated?
A: The WHOIS entry was last updated 3 weeks, 1 day, 11 hours, 29 minutes, 53 seconds ago on Wednesday, September 9, 2020.
Q: What are Wetrecht.nl's nameservers?
A: DNS for Wetrecht.nl is provided by the following nameservers:
  • sandra.neostrada.nl
  • christina.neostrada.nl
  • lisa.neostrada.nl
Q: Who is the registrar for the Wetrecht.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Wetrecht.nl?
A: Wetrecht.nl ranks 573,418 globally on Alexa. Wetrecht.nl has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Wetrecht.nl each day?
A: Wetrecht.nl receives approximately 1,535 visitors and 3,070 page impressions per day.
Q: What IP address does Wetrecht.nl resolve to?
A: Wetrecht.nl resolves to the IPv4 address 31.186.175.119.
Q: In what country are Wetrecht.nl servers located in?
A: Wetrecht.nl has servers located in the Netherlands.
Q: What webserver software does Wetrecht.nl use?
A: Wetrecht.nl is powered by Apache webserver.
Q: Who hosts Wetrecht.nl?
A: Wetrecht.nl is hosted by Serverius Holding B.V. in Netherlands.
Q: How much is Wetrecht.nl worth?
A: Wetrecht.nl has an estimated worth of $2,400. An average daily income of approximately $10, which is roughly $304 per month.

Who hosts Wetrecht.nl?

Wetrecht.nl Hosting Provider Information

Hosted IP Address:31.186.175.119
Hosted Hostname:server.wetrecht.nl
Service Provider:Serverius Holding B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:Apache

Is "Serverius Holding B.V." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Wetrecht.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 09 Sep 2020 17:12:25 GMT
Server: Apache
X-Pingback: http://www.wetrecht.nl/xmlrpc.php
Link:; rel="https://api.w.org/", ; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Wetrecht.nl Domain Nameserver Information

HostIP AddressCountry
sandra.neostrada.nl 85.17.199.26
christina.neostrada.nl 172.104.143.74
lisa.neostrada.nl 66.228.38.167


Need to find out who hosts Wetrecht.nl?


WhoIs information for Wetrecht.nl

 Domain name: wetrecht.nl
Status: active

Registrar:
Totaaldomein B.V.
Reaalhof 64
8232VS LELYSTAD
Netherlands

Abuse Contact:

Creation Date: 2012-02-01

Updated Date: 2014-06-26

DNSSEC: yes

Domain nameservers:
sandra.neostrada.nl
christina.neostrada.nl
lisa.neostrada.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Wetrecht.nl Free SEO Report

Website Inpage Analysis for Wetrecht.nl

H1 Headings

2 :
  1. Uw juridische startpunt
  2. Uw juridische startpunt

H2 Headings

5 :
  1. Kosten rechtszaak
  2. Mogen werknemers overeenkomsten sluiten?
  3. Ziek of arbeidsconflict?
  4. Beslaglegging
  5. Wanprestatie, wat zijn de mogelijkheden?

H3 Headings

3 :
  1. Over ons
  2. Recente blogberichten
  3. Juridische artikelen

H4 Headings

2 :
  1. Rechtsgebieden
  2. Informatie

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

6 :

Google Adsense

:
pub-7181974188771003

Google Analytics

:
UA-33848779-1

Links - Internal

49:
  1. No text
    http://www.wetrecht.nl
  2. Artikelen per rechtsgebied
    http://www.wetrecht.nl/artikelen/
  3. Ondernemersblog
    http://blog.wetrecht.nl/
  4. Homepage
    http://www.wetrecht.nl
  5. Zakelijk
    http://www.wetrecht.nl/zakelijk
  6. Particulier
    http://www.wetrecht.nl/particulier
  7. Artikelen
    http://www.wetrecht.nl/artikelen
  8. Blog
    http://blog.wetrecht.nl
  9. Over ons
    http://www.wetrecht.nl/over-ons
  10. Contact
    http://www.wetrecht.nl/contact
  11. Artikelen
    http://www.wetrecht.nl/artikelen/
  12. Blog
    http://blog.wetrecht.nl/
  13. Lees onze disclaimer
    http://www.wetrecht.nl/disclaimer/
  14. Hoe sluit ik aansprakelijkheid uit in een contract?
    http://blog.wetrecht.nl/hoe-sluit-ik-aansprakelijkheid-uit-in-een-contract/
  15. Wie moet wat bewijzen in een juridisch geschil?
    http://blog.wetrecht.nl/wie-moet-wat-bewijzen-in-een-juridisch-geschil/
  16. Wie mag een contract ondertekenen voor een onderneming?
    http://blog.wetrecht.nl/wie-mag-een-contract-ondertekenen-voor-een-onderneming/
  17. Mag je in slechte tijden het loon van werknemers verlagen?
    http://blog.wetrecht.nl/mag-je-in-slechte-tijden-het-loon-van-werknemers-verlagen/
  18. Product niet in orde: recht op reparatie, vervanging of geld terug?
    http://blog.wetrecht.nl/product-niet-in-orde-recht-op-reparatie-vervanging-of-geld-terug/
  19. Wat kost het een ondernemer om naar de rechter te gaan?
    http://blog.wetrecht.nl/wat-kost-het-een-ondernemer-om-naar-de-rechter-te-gaan/
  20. Hoe beoordeel je of een product juridisch gezien in orde is?
    http://blog.wetrecht.nl/klant-klaagt-dat-geleverd-product-niet-in-orde-is-wat-nu/
  21. Naar alle blogberichten
    http://blog.wetrecht.nl/
  22. No text
    http://www.wetrecht.nl/kosten-rechtszaak/
  23. Kosten rechtszaak
    http://www.wetrecht.nl/kosten-rechtszaak/
  24. … Lees verder
    http://www.wetrecht.nl/kosten-rechtszaak/
  25. No text
    http://www.wetrecht.nl/mogen-werknemers-overeenkomsten-sluiten/
  26. Mogen werknemers overeenkomsten sluiten?
    http://www.wetrecht.nl/mogen-werknemers-overeenkomsten-sluiten/
  27. … Lees verder
    http://www.wetrecht.nl/mogen-werknemers-overeenkomsten-sluiten/
  28. No text
    http://www.wetrecht.nl/ziek-of-arbeidsconflict/
  29. Ziek of arbeidsconflict?
    http://www.wetrecht.nl/ziek-of-arbeidsconflict/
  30. … Lees verder
    http://www.wetrecht.nl/ziek-of-arbeidsconflict/
  31. No text
    http://www.wetrecht.nl/beslaglegging/
  32. Beslaglegging
    http://www.wetrecht.nl/beslaglegging/
  33. … Lees verder
    http://www.wetrecht.nl/beslaglegging/
  34. No text
    http://www.wetrecht.nl/wanprestatie-wat-zijn-de-mogelijkheden/
  35. Wanprestatie, wat zijn de mogelijkheden?
    http://www.wetrecht.nl/wanprestatie-wat-zijn-de-mogelijkheden/
  36. … Lees verder
    http://www.wetrecht.nl/wanprestatie-wat-zijn-de-mogelijkheden/
  37. Naar alle artikelen
    http://www.wetrecht.nl/artikelen/
  38. Arbeidsrecht
    http://www.wetrecht.nl/arbeidsrecht/
  39. Bestuursrecht
    http://www.wetrecht.nl/bestuursrecht/
  40. Civiel recht
    http://www.wetrecht.nl/civielrecht/
  41. Overeenkomsten
    http://www.wetrecht.nl/overeenkomsten/
  42. Ondernemingsrecht
    http://www.wetrecht.nl/ondernemingsrecht/
  43. Procesrecht
    http://www.wetrecht.nl/procesrecht/
  44. Overige
    http://www.wetrecht.nl/overige/
  45. Privacy
    http://www.wetrecht.nl/privacy
  46. Disclaimer
    http://www.wetrecht.nl/disclaimer
  47. Herpublicatie
    http://www.wetrecht.nl/copyright
  48. Cookiebeleid
    http://www.wetrecht.nl/cookiebeleid-eu/
  49. Twitter & Facebook
    http://www.wetrecht.nl/twitter-facebook/

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wetrecht.nl

ziekcurrentindex 1 ifmartikelenwanneeritemamtvoorvaakwateencurrentindex itemamtovereenkomstenlees verderfunctioncurrentindex 01 if currentindexrechtuw1tecycleitemscurrentindex itemamt 1juridischedatwerknemersverderifhoekennisuomdieregelmatig8230 lees verdermet20wezijndisclaimernaar8230 leeswet rechtif currentindexkomtsluitenopleesvarcurrentindexhetwanprestatieitemamt 11 ifkostenwetonsjuridische artikelenallevancurrentindex 1dient

Longtail Keyword Density for Wetrecht.nl

KeywordsOccurences
8230 lees verder5
currentindex 1 if3
1 if currentindex3
currentindex itemamt 13
8230 lees5
lees verder5
currentindex 04
juridische artikelen3
wet recht3
currentindex 13
1 if3
if currentindex3
currentindex itemamt3
itemamt 13
een12
het10
juridische10
currentindex10
08
artikelen7
lees7
van6
voor6
wat5
15
wanneer5
u5
te5
verder5
op5
recht5
overeenkomsten4
cycleitems4
dat4
werknemers4
if4
uw4
itemamt4
24
met4
wanprestatie4
zijn3
ziek3
regelmatig3
function3
komt3
var3
alle3
die3
kosten3
naar3
disclaimer3
hoe3
om3
dient3
wet3
we3
vaak3
sluiten3
ons3
kennis3
m3

Wetrecht.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wetrecht.nl is a scam?

Websites with Similar Names

Wetreat.us
Checkdomain Parking - www.wetreat.us
Wetrecht.nl
Wet & Recht
Wetrecordings.com
Wet Recordings
Wetred.com
The domain name wetred.com is for sale
Wetrek.vn
WETREK.VN - Hệ Thống Trang Bị Thể Thao Ngoài Trời Chính Hãng
Wetrepublic.com
Wet Republic

Recently Updated Websites

Ninetynine.info 1 second ago.Integritycraneservices.com 2 seconds ago.Pornofotosgratis.nl 2 seconds ago.Sissymovies.com 2 seconds ago.Artparket24.ru 3 seconds ago.Lindastyle.com 3 seconds ago.Angelizephotography.com 3 seconds ago.Wixte.com 5 seconds ago.Sayidhotel.com 5 seconds ago.Sesow.com 5 seconds ago.Uufsb.org 5 seconds ago.Thespiritedgirl.com 6 seconds ago.Humco.com 6 seconds ago.Oudejx.com 8 seconds ago.Vocationpromotion.com 10 seconds ago.Toys4you.co.za 10 seconds ago.Onetwothreeloadboard.com 11 seconds ago.Amandahopkins.com 11 seconds ago.Tacotontos.com 11 seconds ago.Pspartyband.com 11 seconds ago.Ttprep.com 11 seconds ago.Symsyj.com 12 seconds ago.Saltcitynoir.org 12 seconds ago.Cloudknox.biz 12 seconds ago.Oklahoma-criminal-defense.com 13 seconds ago.Arimaa.com 15 seconds ago.Neomyxus.com 16 seconds ago.Jnlywy.com 16 seconds ago.Barsinghausen.de 17 seconds ago.Wodwiz.net 17 seconds ago.