Wetter.de  |  Wetter - Wettervorhersage - Wetterbericht - wetter.de
Low trust score  | 
Wetter ✓ Regenradar ✓ Unwetterwarnung ✓ Pollenflug ✓ Pegelstände ✓ Skiwetter ✓ Wettervorhersage für Deutschland ✓ - wetter.de

Wetter.de Website Information

Wetter.de has a Low Trust Score, a Statvoo Rank of C, an Alexa Rank of 3,528, a Majestic Rank of 22,050, a Domain Authority of 81% and is not listed in DMOZ.

Wetter.de is hosted by Datacenter Luxembourg S.A. in Luxembourg.
Wetter.de has an IP Address of 80.92.90.41 and a hostname of drall.eurodns.com and runs Apache/2.4.7 (Ubuntu) web server.

The domain wetter.de was registered 201 decades 9 years 5 days ago by , it was last modified 1 decade 4 months 3 weeks ago and currently is set to expire 201 decades 9 years 5 days ago.


Whois information for wetter.de

Full Whois Lookup for Wetter.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: wetter.de
Nserver: ns1.eurodns.com
Nserver: ns2.eurodns.com
Nserver: ns3.eurodns.com
Nserver: ns4.eurodns.com
Status: connect
Changed: 2016-07-26T12:34:07+02:00

[Tech-C]
Type: ROLE
Name: IT Service
Organisation: EuroDNS SA
Address: 2 rue Leon Laval
PostalCode: L-3372
City: Leudelange
CountryCode: LU
Phone: +352 26372525
Fax: +352 26372537
Email: Login to show email
2009-05-19T10:45:13+02:00

[Zone-C]
Type: ROLE
Name: IT Service
Organisation: EuroDNS SA
Address: 2 rue Leon Laval
PostalCode: L-3372
City: Leudelange
CountryCode: LU
Phone: +352 26372525
Fax: +352 26372537
Email: Login to show email
2009-05-19T10:45:13+02:00

Who hosts Wetter.de?

Wetter.de Web Server Information

Hosted IP Address:80.92.90.41
Hosted Hostname:drall.eurodns.com
Service Provider:Datacenter Luxembourg S.A.
Hosted Country:LuxembourgLU
Location Latitude:49.75
Location Longitude:6.1667
Webserver Software:Apache/2.4.7 (Ubuntu)

HTTP Header Analysis for Wetter.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache/2.4.6 (Unix)
X-Node: web-fra21
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Type: text/html;charset=utf-8
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
X-Device: desktop
X-Content-Age: 12
Content-Length: 18278
Accept-Ranges: bytes
Date: Mon, 08 Jun 2015 14:23:25 GMT
X-Varnish: 1422317106 1422292939
Age: 291
Via: 1.1 varnish
Connection: keep-alive


Need to find out who hosts Wetter.de?

Wetter.de Free SEO Report

Website Inpage Analysis for Wetter.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-4589480935500444
Google Analytics:Not Applicable

Keyword Cloud for Wetter.de

sachsenanhalt21 august usader satellitenfilm fr1amobfr diewassertemperaturengrillwetter wassertemperaturenladendabei11saarlandder sofi zugeben6gewitternordrheinwestfalenbieten wirklasseusa12sofiweiterecsehenc nbspwir ihnenberichte40 lmvomgrillwettereinemgenauvonsocial mediaklimaeuropa vomerkltungswetteram 21 augustadplayercountermodulimerklren sienbspvon derinformationenwerbungwie16neuekriegennewswartet auf den3prognosen10thailanddasaustralienaugusteuropawetterdeaugust usa warteterklren sie sichthisadcallmediaunsereclipseday auch wirknnensofi zukeine chance dervon der sofisonnenfinsternis amauf denantarktis asienkeine chancewartet aufregenallenichtdas wettereshochs habenstrmungsfilm fr europaunter2aktuellederauch wirfreizeithessensonnenfinsternis am 21wetterberichtantarktis asien australiender welt5 lmerklrenfr europa vomwetterkarten aktuelles wettersie sichindividualadcallusa warteteineperfektunssodie hochsberichte und prognosen4zumfr deutschlandasien australientrkeisatellitenfilm fr europaden eclipseday aucheinder satellitenfilmder sofifrthringensonnenfinsterniswartetjetztunwetterkeine19niedersachsentypeofzurzu15tage3 lmhaben keinesich18berafrika antarktis asienhochs haben keinedatenblitzradarganzantarktisaugust usaloginbadenwrttemberg7mecklenburgvorpommerndenchance der satellitenfilmeuropa vom 17082017varbietenchance derden eclipsedaydie hochs habenschleswigholsteinitalienspaniennordamerikaeinverstanden8 lmreturn10 lmauch917afrika antarktissiedazufr siewir kriegenaustralien europadiesewetterkarten aktuellesihrpremiumwetterwetterkarten0usa wartet aufhamburgwirdrheinlandpfalzprofilesocialfunctionlmhaben20 lmeclipseday auch821 august4 lmkriegen was vonbremenok5berlinvorhersageumklickenweitere informationenstrmungsfilm frwerdenpollenflugeuropa nordamerika sdamerikazu sehenhaben keine chanceaustralien europa nordamerikahierbeimallorcaistspezialkartensachsensowie13nurimmer15 lmnochauch wir kriegenweitere informationen okbietetdeutschlandmchtencookiesortreturn thisadcallchancebeistrmungsfilmgesundheitunsererknnen sieihnenhochsihreunseredemwettersdamerikadiedesfr europaandereaufodereclipsedayvorausvom 17082017weltgriechenlandwettervorhersagenordamerika sdamerikainformationen oksatellitenfilmbrandenburggibtaktuelles wettereuropa nordamerikawirsofi zu sehenasien australien europaauf den eclipsedayim vorausifunserenafrikawerden vonam 212014topmckenverwendenregenradarsatellitenfilm frasienbayernmitaktuelles

Longtail Keyword Density for Wetter.de

KeywordsOccurences
berichte und prognosen7
wartet auf den3
auf den eclipse-day3
den eclipse-day auch3
usa wartet auf3
august usa wartet3
am 21 august3
21 august usa3
eclipse-day auch wir3
auch wir kriegen3
erklren sie sich3
weitere informationen ok3
sofi zu sehen3
der sofi zu3
kriegen was von3
von der sofi3
sonnenfinsternis am 213
europa nordamerika sdamerika3
chance der satellitenfilm3
der satellitenfilm fr3
keine chance der3
haben keine chance3
die hochs haben3
hochs haben keine3
satellitenfilm fr europa3
fr europa vom3
asien australien europa3
australien europa nordamerika3
antarktis asien australien3
afrika antarktis asien3
europa vom 170820173
strmungsfilm fr europa3
wetterkarten aktuelles wetter3
20 lm17
15 lm13
8 lm11
fr europa7
c nbsp7
das wetter6
sie sich6
10 lm5
vom 170820175
fr die4
5 lm4
4 lm4
von der4
keine chance4
fr deutschland4
40 lm3
sofi zu3
werden von3
fr sie3
social media3
return thisadcall3
3 lm3
zu sehen3
informationen ok3
knnen sie3
der sofi3
bieten wir3
der welt3
erklren sie3
weitere informationen3
im voraus3
wir ihnen3
den eclipse-day3
europa vom3
satellitenfilm fr3
strmungsfilm fr3
afrika antarktis3
antarktis asien3
der satellitenfilm3
chance der3
grillwetter wassertemperaturen3
aktuelles wetter3
die hochs3
hochs haben3
haben keine3
asien australien3
australien europa3
auf den3
wartet auf3
wetterkarten aktuelles3
eclipse-day auch3
auch wir3
usa wartet3
august usa3
nordamerika sdamerika3
europa nordamerika3
sonnenfinsternis am3
am 213
21 august3
wir kriegen3
lm65
wetter51
die37
fr36
der27
sie26
024
wir19
deutschland18
auf18
von17
das17
zu17
116
europa15
214
werden13
auch12
wetterde12
daten12
es12
mit12
311
ihnen11
im9
oder9
wetterkarten9
sich8
den8
nbsp8
eine8
var8
vom7
jetzt7
uns7
47
knnen7
c7
berichte7
regenradar7
prognosen7
56
66
einem6
76
ist6
welt6
usa6
wettervorhersage6
wird6
um6
86
tage6
profile6
ok6
unwetter6
95
noch5
grillwetter5
bieten5
dem5
so5
105
115
125
berlin5
typeof5
wie5
unsere5
bei5
sehen5
satellitenfilm5
keine5
haben5
nicht5
aktuelle5
antarktis5
if4
gewitter4
chance4
diese4
ihre4
function4
unter4
social4
adplayercountermodul4
return4
134
klasse4
italien4
144
154
hamburg4
bremen4
164
voraus4
mchten4
perfekt4
wetterbericht4
174
ob4
klima4
unseren4
genau4
informationen4
wassertemperaturen4
nur4
zur4
cookies4
bietet3
dabei3
login3
einverstanden3
unser3
ihr3
unserer3
thisadcall3
geben3
individualadcall3
des3
erklren3
media3
ber3
weitere3
hierbei3
ort3
ein3
sowie3
verwenden3
premiumwetter3
dazu3
werbung3
pollenflug3
gesundheit3
erkltungswetter3
spezialkarten3
vorhersage3
aktuelles3
freizeit3
blitzradar3
andere3
griechenland3
mcken3
laden3
neue3
thringen3
schleswig-holstein3
brandenburg3
hessen3
bayern3
baden-wrttemberg3
183
mecklenburg-vorpommern3
niedersachsen3
sachsen3
sachsen-anhalt3
saarland3
rheinland-pfalz3
nordrhein-westfalen3
spanien3
hochs3
gibt3
zum3
sofi3
kriegen3
eclipse-day3
alle3
klicken3
193
regen3
immer3
mallorca3
top3
wartet3
august3
asien3
australien3
afrika3
strmungsfilm3
ganz3
nordamerika3
sdamerika3
sonnenfinsternis3
am3
news3
thailand3
trkei3
203

What are the nameservers for wetter.de?

Wetter.de Domain Nameserver Information

HostIP AddressCountry
ns1.eurodns.com 204.74.66.130United States United States
ns2.eurodns.com 204.74.110.130United States United States
ns3.eurodns.com 204.74.67.130United States United States
ns4.eurodns.com 204.74.111.130United States United States

Wetter.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wetter.de is a scam?