UN World Food Programme (WFP)

Safety: High trust score
Year Founded: 1994
Global Traffic Rank: 4,291
Estimated Worth: $3,764,880

We are the world’s largest humanitarian organization, saving lives in emergencies and using food assistance to build a pathway to peace, stability and prosperity for people recovering from conflict, disasters and the impact of climate change.



Domain summary

Last updated
2022-02-01
Domain label
wfp
Domain extension
org
Domain registered:
1994-06-10
Domain updated:
2022-02-01
Global Traffic Rank
4,291
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$3,764,880
Estimated daily income
$3,486
Estimated monthly income
$106,033

Frequently Asked Questions (FAQ)

Q: When was Wfp.org registered?
A: Wfp.org was registered 27 years, 11 months, 2 weeks, 16 hours, 35 minutes, 21 seconds ago on Friday, June 10, 1994.
Q: When was the WHOIS for Wfp.org last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 2 days, 16 hours, 35 minutes, 21 seconds ago on Tuesday, February 1, 2022.
Q: What are Wfp.org's nameservers?
A: DNS for Wfp.org is provided by the following nameservers:
  • ns2.it.colt.net
  • ns.it.colt.net
Q: Who is the registrar for the Wfp.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Wfp.org?
A: Wfp.org ranks 4,291 globally on Alexa. Wfp.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Wfp.org each day?
A: Wfp.org receives approximately 435,796 visitors and 3,486,368 page impressions per day.
Q: What IP address does Wfp.org resolve to?
A: Wfp.org resolves to the IPv4 address .
Q: In what country are Wfp.org servers located in?
A: Wfp.org has servers located in the .
Q: What webserver software does Wfp.org use?
A: Wfp.org is powered by Apache webserver.
Q: Who hosts Wfp.org?
A: Wfp.org is hosted by Unknown in .
Q: How much is Wfp.org worth?
A: Wfp.org has an estimated worth of $3,764,880. An average daily income of approximately $3,486, which is roughly $106,033 per month.

Wfp.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wfp.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wfp.org

H1 Headings

1 :
  1. ‘Our presence is hope’: US$2.6 billion needed as winter spells hunger for Afghanistan

H2 Headings

17 :
  1. Afghanistan key stats
  2. A one-time appeal
  3. 4 countries face famine, UN report warns
  4. Yemen: funding crunch threatens life-saving work
  5. The airstrip where hope takes off
  6. Climate crisis: Things to watch in 2022
  7. 2020 Nobel Peace Prize Laureate
  8. Saving lives in emergencies
  9. Changing lives worldwide
  10. Where we work
  11. Emergencies
  12. Who we are
  13. Our work
  14. About hunger
  15. Get involved
  16. Work with us
  17. Media & resources

H3 Headings

31 :
  1. ABOUT
  2. TRANSPARENCY AND ACCOUNTABILITY
  3. PARTNERSHIPS
  4. ABOUT HUNGER
  5. SAVING LIVES
  6. CHANGING LIVES
  7. SUPPORTING GOVERNMENTS
  8. INNOVATION AND DIGITAL TRANSFORMATION
  9. WHERE WE WORK
  10. Countries
  11. Emergencies
  12. INDIVIDUAL SUPPORTERS
  13. COMPANIES AND START-UPS
  14. PARTNERS
  15. MEDIA CENTRE
  16. RESOURCES & DATA
  17. Food assistance: cash-based and in-kind
  18. Resilience building
  19. Nutrition
  20. School health and nutrition
  21. Social protection and safety nets
  22. Climate action
  23. Smallholder farmers market support
  24. Country capacity strengthening and south-south cooperation
  25. ABOUT
  26. PARTNERSHIPS
  27. TRANSPARENCY AND ACCOUNTABILITY
  28. SAVING LIVES
  29. CHANGING LIVES
  30. SUPPORTING GOVERNMENTS
  31. INNOVATION AND DIGITAL TRANSFORMATION

H4 Headings

3 :
  1. WFP in numbers
  2. WFP Annual Performance Report 2020
  3. Hunger Map Live

H5 Headings

3 :
  1. 115.5 million people in 84 countries
  2. 5.6K trucks 100 aircraft and 30 ships
  3. 17 million children across the world

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

207:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wfp.org

climate changesouthsouthbuildinnovationsmallholder farmerswe providecooperationaccountabilitysavingsustainablereadnationalenablingstrengthening0vulnerablegovernmentsjanuaryresourcessmallholderchanging livesanypeopleprovideprogrammesresiliencelivescashcountrymillionsocial protectionreceivedcountry capacity strengtheningstoryshocksfundingchangingfood securitycountrieschangesystemsourclimatedemocraticafghanistansouthsouth cooperationreportimprovelivelihoodshaspartnersmoremarket supportthemallagenciesfamineriskemergencycapacitycongofacepotential1healthschoolbasedlocalthroughwe workchainunnutritionhumanitarianconflictsocialwfpssaving livesinternationalampemergencieswfpmapkgresponsesudanjanuary 2022disastersincludingun agenciesemergencies wemedianewspartnershipsactionbuildingusfoodhungerchildrensupportrisksassistancetheirothersecuritytechnologyfood assistancefarmersservicesgetweclimate actionyemennutritiousdemocratic republicmarketour emergencies weworkcountry capacitydomillion peoplenigeriaschoolmostresilience buildingmore about ourneedtechnicalclustersread morecapacity strengtheningrepublicour emergenciesmadagascardevelopmentcommunitiesfood systemsworlddonateperformanceprotection

Longtail Keyword Density for Wfp.org

KeywordsOccurences
more about our6
country capacity strengthening3
our emergencies we3
read more15
our emergencies6
we work5
saving lives4
food security4
market support4
food systems4
resilience building4
smallholder farmers4
january 20224
social protection4
food assistance4
million people4
we provide3
climate change3
south-south cooperation3
un agencies3
democratic republic3
capacity strengthening3
country capacity3
climate action3
changing lives3
emergencies we3
food25
wfp24
we19
more19
emergency19
read16
our15
support14
emergencies13
hunger13
people13
work11
republic11
climate10
governments9
assistance9
lives8
countries8
humanitarian8
partners8
their7
cash7
nutrition7
programmes7
un6
donate6
06
congo5
afghanistan5
us5
other5
agencies5
international5
media5
local5
vulnerable5
million5
innovation5
them5
world5
resources5
saving5
systems5
resilience5
capacity5
country5
smallholder5
protection4
through4
services4
face4
risk4
story4
january4
famine4
need4
all4
security4
most4
nutritious4
partnerships4
provide4
response4
accountability4
including4
school4
national4
market4
conflict4
sudan4
building4
democratic4
sustainable4
livelihoods4
farmers4
social4
health3
strengthening3
cooperation3
performance3
potential3
wfps3
do3
risks3
development3
map3
technology3
children3
funding3
communities3
has3
improve3
madagascar3
news3
nigeria3
school-based3
changing3
chain3
amp3
clusters3
received3
kg3
south-south3
report3
get3
action3
13
build3
disasters3
change3
yemen3
shocks3
any3
enabling3
technical3

Who hosts Wfp.org?

Wfp.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%

HTTP Header Analysis for Wfp.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 01 Feb 2022 05:16:55 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 15975
Connection: keep-alive
Server: Apache
Cache-Control: must-revalidate, no-cache, private
X-Drupal-Dynamic-Cache: MISS
Link:; rel="alternate"; hreflang="sv"
X-UA-Compatible: IE=edge
Content-language: en
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Permissions-Policy: interest-cohort=()
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Content-Security-Policy: default-src 'self'; script-src 'self' cdn.wfp.org *.jwplatform.com www.google.com www.googletagmanager.com tagmanager.google.com www.google-analytics.com survey.g.doubleclick.net *.doubleclick.net *.adalyser.com *.jwpcdn.com www.gstatic.com adservice.google.com connect.facebook.net www.facebook.com squizlabs.github.io cdnjs.cloudflare.com unpkg.com cdn.sparkcentral.com *.smooch.io *.user1st.info www.googleadservices.com bat.bing.com sixeleven.involve.me assets.juicer.io *.typekit.net 'unsafe-inline' 'unsafe-eval'; style-src 'self' 'unsafe-inline' 'unsafe-eval' cdn.wfp.org tagmanager.google.com fonts.googleapis.com *.bootstrapcdn.com squizlabs.github.io cdn.sparkcentral.com *.user1st.info assets.juicer.io *.typekit.net; img-src 'self' blob: https: data:; media-src 'self' content.jwplatform.com *.jwpsrv.com cdn.jwplayer.com cdn.sparkcentral.com *.user1st.info blob:; frame-src 'self' *.jwpsrv.com www.google.com survey.g.doubleclick.net *.doubleclick.net cdn.knightlab.com forms.office.com content.jwplatform.com *.user1st.info www.youtube-nocookie.com sixeleven.involve.me saveful.com; child-src 'self' blob:; font-src 'self' cdn.wfp.org *.jwpcdn.com fonts.gstatic.com *.bootstrapcdn.com cdn.sparkcentral.com *.user1st.info static.juicer.io *.typekit.net data:; connect-src 'self' data: cdn.wfp.org geonode.wfp.org www.google-analytics.com api.mapbox.com geoip.nekudo.com api.ipify.org api.ip2country.info mycountry.picktek.org content.jwplatform.com *.jwpsrv.com cdn.jwplayer.com acr.api.spring.wfp.org cdn.sparkcentral.com *.smooch.io *.user1st.info stats.g.doubleclick.net fh.mg.wfp.org geoip.maxmind.com www.juicer.io juicer.io graph.facebook.com *.typekit.net *.sentry.io bat.bing.com 'self' ws:; report-uri /report-csp-violation; upgrade-insecure-requests
X-XSS-Protection: 1; mode=block
Strict-Transport-Security: max-age=2592000
Referrer-Policy: no-referrer-when-downgrade
X-Permitted-Cross-Domain-Policies: none
Access-Control-Expose-Headers: *
X-Drupal-Cache: HIT
Vary: Accept-Encoding
Content-Encoding: gzip

Wfp.org Domain Nameserver Information

HostIP AddressCountry
ns2.it.colt.net 212.74.77.46United Kingdom United Kingdom
ns.it.colt.net 212.74.78.46United Kingdom United Kingdom


Need to find out who hosts Wfp.org?


Domain Registration (WhoIs) information for Wfp.org

 Domain Name: WFP.ORG
Registry Domain ID: D2961671-LROR
Registrar WHOIS Server: whois.psi-usa.info
Registrar URL: http://www.psi-usa.info
Updated Date: 2021-10-06T01:20:36Z
Creation Date: 1994-10-06T04:00:00Z
Registry Expiry Date: 2022-10-05T04:00:00Z
Registrar Registration Expiration Date:
Registrar: PSI-USA, Inc. dba Domain Robot
Registrar IANA ID: 151
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.94159559482
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: World Food Programme (WFP)
Registrant State/Province: RM
Registrant Country: IT
Name Server: NS2.IT.COLT.NET
Name Server: NS.IT.COLT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-12-11T08:59:08Z

Websites with Similar Names

Wfp-d.org
Women Learn and Lead النساء تتعلم وتقود
Wfp-inc.com
HOME | Machined Plastics
Wfp-nl.com
Welcome to Foodtrend
Wfp-pma.com
Error 404 (Not Found)!!1
Wfp-shomura.com
仙台の鍋料理 専心会席「庄村」(仙台市国分町)
Wfp-taxes.com
Welcome To WFP Tax Partners in Historic Liberty Corner, NJ | WFP TAX PARTNERS,LLC
Wfp.ca
PH2 – Tech and Thoughts – Tech and Thoughts
Wfp.com
WASHINGTON FINE PROPERTIES: Representing The Finest Properties in the Nation's Capital Region & Virginia Countryside

Recently Updated Websites

Texasmetalstructures.com (43 minutes 59 seconds ago.)Thesamuellawfirm.com (1 hour 2 minutes ago.)Ram-comparison.com (1 hour 7 minutes ago.)Bidderopt.com (1 hour 43 minutes ago.)Datahubserv.com (1 hour 45 minutes ago.)Dom472.solsijax.ru (1 hour 48 minutes ago.)Plombier-paris-19e.com (1 hour 53 minutes ago.)Alamaula.com.co (1 hour 56 minutes ago.)Vsalon24.ru (1 hour 57 minutes ago.)Ductcleaningalbuquerquenm.com (2 hours 38 minutes ago.)Matribhasha.com (3 hours 50 seconds ago.)Montsaintmichel.com (3 hours 22 minutes ago.)Ricarsalon.com (3 hours 37 minutes ago.)789betsam.com (3 hours 40 minutes ago.)Water-sporter.site (3 hours 46 minutes ago.)Phillipsj.net (3 hours 59 minutes ago.)Areaconvert.com (4 hours 15 minutes ago.)Auctim.com (4 hours 20 minutes ago.)Huayclub.co (4 hours 41 minutes ago.)Heng168.vip (4 hours 52 minutes ago.)Trafficsafety.reviews (4 hours 58 minutes ago.)My-equipment.com (4 hours 58 minutes ago.)Allhotsale.com (5 hours 2 minutes ago.)Specagra.lt (5 hours 9 minutes ago.)2048arena.com (5 hours 11 minutes ago.)Pornnit.com (5 hours 11 minutes ago.)Rusticillusions.com (5 hours 25 minutes ago.)Bonsbons.in (5 hours 25 minutes ago.)Ludzie-biznesu.pl (5 hours 46 minutes ago.)Nimbbl.biz (6 hours 9 minutes ago.)

Recently Searched Keywords

japanese massage porn (1 second ago.)11. sınıf (3 seconds ago.)the library (3 seconds ago.)bob white: a good guy gets a lift through a bad time (4 seconds ago.)early team news: strikers ruled outexternal link (5 seconds ago.)playrsquon (6 seconds ago.)cienkie (7 seconds ago.)solicitar demo (7 seconds ago.)legno invecchiato (9 seconds ago.)24 480 (10 seconds ago.)infused water (11 seconds ago.)иностранные языки (12 seconds ago.)black french man meme (12 seconds ago.)anti-inflamatórios (13 seconds ago.)illyrian (14 seconds ago.)vivere (14 seconds ago.)padding-top 27px padding-bottom (15 seconds ago.)27px padding-bottom (16 seconds ago.)how to grow purple haze marijuana indoors (17 seconds ago.)tracklinkstrue accuratetrackbouncetrue webvisortrue (17 seconds ago.)fructiweb (22 seconds ago.)amp localvehicles amp (22 seconds ago.)social-media (23 seconds ago.)մեր պաշտոնական էջը facebook-ում (25 seconds ago.)california privacy (25 seconds ago.)cameras for careers (26 seconds ago.)text-decoration-style initial text-decoration-color (28 seconds ago.)border-width1px background-colorrgba225 242 (29 seconds ago.)false autoplaytime (29 seconds ago.)govt. jobs after graduation (30 seconds ago.)