Whiteskids.org Favicon Whiteskids.org

Whiteskids.org Website Thumbnail
Checking...
Home Page | White's Residential and Family Services
Low trust score
Add a review Change category Claim this site
White's helps families in crisis, in transition and in need of support through services, including adoption, foster care and residential programs.


Domain summary

Domain label
whiteskids
Domain extension
org
Domain registered:
2002-10-10
Domain updated:
2020-09-06
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is whiteskids.org ranked relative to other sites:

Percentage of visits to whiteskids.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Whiteskids.org registered?
A: Whiteskids.org was registered 17 years, 11 months, 2 weeks, 6 days, 9 hours, 46 minutes, 11 seconds ago on Thursday, October 10, 2002.
Q: When was the WHOIS for Whiteskids.org last updated?
A: The WHOIS entry was last updated 3 weeks, 3 days, 9 hours, 46 minutes, 11 seconds ago on Sunday, September 6, 2020.
Q: What are Whiteskids.org's nameservers?
A: DNS for Whiteskids.org is provided by the following nameservers:
  • ns2105.hostgator.com
Q: Who is the registrar for the Whiteskids.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Whiteskids.org?
A: Whiteskids.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Whiteskids.org each day?
A: Whiteskids.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Whiteskids.org resolve to?
A: Whiteskids.org resolves to the IPv4 address .
Q: In what country are Whiteskids.org servers located in?
A: Whiteskids.org has servers located in the .
Q: What webserver software does Whiteskids.org use?
A: Whiteskids.org is powered by Nginx webserver.
Q: Who hosts Whiteskids.org?
A: Whiteskids.org is hosted by Unknown in .
Q: How much is Whiteskids.org worth?
A: Whiteskids.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Whiteskids.org?

Whiteskids.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Whiteskids.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 06 Sep 2020 18:51:44 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
Vary: Accept-Encoding,Cookie
Link:; rel=shortlink
Expires: Mon, 05 Oct 2020 16:52:57 GMT
X-Powered-By: WP Engine
X-Cacheable: YES:2592000.000
Cache-Control: max-age=2592000, must-revalidate
X-Cache: HIT: 93
X-Cache-Group: normal
Content-Encoding: gzip

Whiteskids.org Domain Nameserver Information

HostIP AddressCountry
ns2105.hostgator.com 50.87.144.192United States United States


Need to find out who hosts Whiteskids.org?


WhoIs information for Whiteskids.org

 Domain Name: WHITESKIDS.ORG
Registry Domain ID: D91099813-LROR
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2018-10-03T18:40:51Z
Creation Date: 2002-10-10T20:46:58Z
Registry Expiry Date: 2022-10-10T20:46:58Z
Registrar Registration Expiration Date:
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS2105.HOSTGATOR.COM
Name Server: NS2106.HOSTGATOR.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-11T00:05:58Z

Whiteskids.org Free SEO Report

Website Inpage Analysis for Whiteskids.org

H1 Headings

1 :
  1. Hope.

H2 Headings

0 :

H3 Headings

2 :
  1. Become a Foster Parent: Give a child a life to remember.
  2. For more than 160 years

H4 Headings

16 :
  1. The White’s Ministry
  2. Teaching-Family Model Services
  3. Make a difference.Careers.
  4. Leave your Legacy. Donate.
  5. Josiah White’s Story
  6. Residential Services
  7. Take a look atCampus
  8. White’s has helped families in crisis, in transition and in need of support.
  9. Residential Programs toRedirect, Rebuild & Restore
  10. MAP
  11. PATH
  12. TREC Program
  13. Growing Teens For Life
  14. purpose.
  15. Stay in the loop.
  16. Main Campus

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

35 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-50304030-1

Links - Internal

43:
  1. No text
    https://whiteskids.org
  2. 50 East
    https://whiteskids.org/50-east/
  3. Residential Services
    https://whiteskids.org/residential-services/
  4. TREC
    https://whiteskids.org/residential-services/trec/
  5. MAP
    https://whiteskids.org/residential-services/map/
  6. PATH
    https://whiteskids.org/residential-services/path/
  7. Jr./Sr. High School
    https://whiteskids.org/residential-services/jr-sr-high-school/
  8. Growing Teens For Life
    https://whiteskids.org/residential-services/growing-teens-for-life/
  9. Foster Care
    https://whiteskids.org/family-services/foster-care/
  10. Family Preservation
    https://whiteskids.org/family-services/preservation-services/
  11. Family Services
    https://whiteskids.org/family-services/
  12. Become a Foster Parent
    https://whiteskids.org/family-services/foster-care/
  13. About
    https://whiteskids.org/about/
  14. History
    https://whiteskids.org/about/history/
  15. Philosophy
    https://whiteskids.org/about/philosophy/
  16. Leadership
    https://whiteskids.org/about/leadership/
  17. Results
    https://whiteskids.org/about/results/
  18. News
    https://whiteskids.org/about/news/
  19. Events
    https://whiteskids.org/about/events/
  20. Careers
    https://whiteskids.org/careers/
  21. Donate
    https://whiteskids.org/donate/
  22. 401 (K)ids Plan
    https://whiteskids.org/donate/401-kids-plan/
  23. Planned Giving
    https://whiteskids.org/donate/planned-giving/
  24. GTFL Donation
    https://whiteskids.org/gtfl-donation/
  25. Impact Partners
    https://whiteskids.org/donate/impact-partners/
  26. Contact Us
    https://whiteskids.org/contact/
  27. Locations
    https://whiteskids.org/contact/locations/
  28. Referrals
    https://whiteskids.org/contact/referrals/
  29. Schedule a Tour
    https://whiteskids.org/contact/schedule-a-tour/
  30. Refer a Teen
    http://whiteskids.org/contact/referrals/
  31. Become a Foster Parent
    http://whiteskids.org/family-services/foster-care/
  32. Learn More
    http://whiteskids.org/residential-services/teaching-family-model/
  33. Career Opportunities >>
    https://whiteskids.org/careers
  34. Learn More >>
    https://whiteskids.org/donate/
  35. Learn More >>
    https://whiteskids.org/about/history/
  36. Learn More >>
    https://whiteskids.org/residential-services/
  37. Learn More >>
    https://whiteskids.org/residential-services/jr-sr-high-school/
  38. Discover the Program
    https://whiteskids.org/family-services/foster-care/
  39. Learn More
    https://whiteskids.org/about/
  40. Learn More
    https://whiteskids.org/residential-services/
  41. Career Opportunities
    https://whiteskids.org/careers/
  42. Father Engagement
    https://whiteskids.org/family-services/father-engagement/
  43. Privacy Policy
    https://whiteskids.org/privacy-policy/

Links - Internal (nofollow)

0:

Links - Outbound

12:
  1. No text
    https://www.facebook.com/Whites-Residential-Family-Services-132125810158661/
  2. No text
    https://www.youtube.com/channel/UC0eNVdKReCj-4xIDlTRg9gA
  3. No text
    https://www.youtube.com/channel/UCe1gh4JeRTCl_VSldR5MR5A
  4. Compass Rose Academy
    http://compassroseacademy.org/?utm_source=whites&utm_medium=referral&utm_campaign=menu
  5. Emails are serviced by Constant Contact
    https://www.constantcontact.com/legal/service-provider
  6. Compass Rose Academy
    https://connect.whitesrfs.org/site/Donation2?df_id=1500&mfc_pref=T&1500.donation=form1
  7. COVID-19 Information
    https://14rcd02hux3e4fi1q2u75641-wpengine.netdna-ssl.com/wp-content/uploads/2020/07/WRFS-COVID-19-Notice-for-web-7-22-20-update.pdf
  8. No text
    http://coanet.org/home/
  9. No text
    https://www.in.gov/dcs/
  10. No text
    https://www.ecfa.org/Content/Standards
  11. No text
    https://www.guidestar.org/profile/35-0883520
  12. Wellness Policy
    http://14rcd02hux3e4fi1q2u75641-wpengine.netdna-ssl.com/wp-content/uploads/2018/01/Whites-Wellness-Policy.pdf

Links - Outbound (nofollow)

0:

Keyword Cloud for Whiteskids.org

teens0academytokencampuswabashmoreyouyourjparentcompass rose academygrecaptchaformjquerygtgtfamily servicesvarmapeast1canemailsourtreclearn more gtgt50 eastfamiliesrose academyfalsecompass roseresidentialteens for lifecontactwhitesservicescareiffamilydonategrowinggrowing teenslifedocumentaddeventlistenerfosterdisabledlearn moreactionsanronloadcallbackfoster parentprogramcompassbecome a fosterrosereceivecareerbecomemore gtgtfunctionpathlearnaction

Longtail Keyword Density for Whiteskids.org

KeywordsOccurences
become a foster4
learn more gtgt4
compass rose academy3
teens for life3
learn more7
family services4
foster parent4
more gtgt4
50 east3
compass rose3
rose academy3
growing teens3
function12
var11
more9
learn7
life6
foster6
program6
family6
services6
residential6
gtgt5
form5
false5
our5
documentaddeventlistener4
grecaptcha4
anronloadcallback4
emails4
action4
token4
if4
04
whites4
parent4
teens4
become4
j4
your4
you4
rose3
actions3
disabled3
jquery3
trec3
map3
path3
13
compass3
growing3
academy3
career3
can3
families3
east3
receive3
donate3
wabash3
campus3
contact3
care3

Whiteskids.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Whiteskids.org is a scam?

Websites with Similar Names

White--pages.com
WHITE--PAGES.COM
White-academy.com
WebsiteBuilder
White-ad.com
Home | WAD
White-aerography.ru
white aerography | Аэрография в интерьере и экстерьере
White-analytics.com
Welcome to white-analytics.com
White-and-black-garments.com
White&Black Garments - Awesome clothing for awesome people
White-and-dirty.com
Site Unavailable
White-angel-star-radio.de
white-angel-star-radio.de - News

Recently Updated Websites

Doineauboismat.com 1 second ago.Edwardsdna.com 1 second ago.Guyanaobservernews.org 2 seconds ago.Typelesonline.nl 2 seconds ago.Jacksdrivingschoolva.com 2 seconds ago.Schafgarbentee.de 3 seconds ago.Cryptarismission.com 5 seconds ago.Nefloridarawdogfood.com 6 seconds ago.99businessnewspapers.com 7 seconds ago.Bibleserralta.com 7 seconds ago.Neohausargentina.com 8 seconds ago.Compagniadellalunacrescente.it 8 seconds ago.Steporebook.com 9 seconds ago.Impulsenutrition.org 9 seconds ago.Skmtsocial.com 9 seconds ago.Shopthatlbd.com 9 seconds ago.Homeheatingservice.com 10 seconds ago.32barcuts.com 10 seconds ago.Kaizenhitech.com 11 seconds ago.Flxconstruction.com 11 seconds ago.Free911263.net 11 seconds ago.Selobordamos.com 12 seconds ago.Hatamoto.biz 12 seconds ago.66jjg.com 14 seconds ago.Visionarylandscapesllc.com 14 seconds ago.Grosirkulit.com 14 seconds ago.Youcool.org 15 seconds ago.Onlinepsd.com 15 seconds ago.Noryaw.ir 15 seconds ago.Vitalsignsconference.com 15 seconds ago.