Whselfinvest.de Website Information

Whselfinvest.de has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 335,424, a Majestic Rank of 0, a Domain Authority of 34% and is not listed in DMOZ.

Whselfinvest.de is hosted by Netline S.A. in Luxembourg.
Whselfinvest.de has an IP Address of 212.24.195.91 and a hostname of 212.24.195.91.static.netline.lu.

The domain whselfinvest.de was registered 201 decades 9 years 4 days ago by , it was last modified 1 decade 4 months 3 weeks ago and currently is set to expire 201 decades 9 years 4 days ago.


Whois information for whselfinvest.de

Full Whois Lookup for Whselfinvest.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: whselfinvest.de
Nserver: ns1.eurodns.com
Nserver: ns2.eurodns.com
Status: connect
Changed: 2014-08-04T09:10:27+02:00

[Tech-C]
Type: ROLE
Name: IT Service
Organisation: EuroDNS SA
Address: 2 rue Leon Laval
PostalCode: L-3372
City: Leudelange
CountryCode: LU
Phone: +352 26372525
Fax: +352 26372537
Email: Login to show email
2009-05-19T10:45:13+02:00

[Zone-C]
Type: ROLE
Name: IT Service
Organisation: EuroDNS SA
Address: 2 rue Leon Laval
PostalCode: L-3372
City: Leudelange
CountryCode: LU
Phone: +352 26372525
Fax: +352 26372537
Email: Login to show email
2009-05-19T10:45:13+02:00

Who hosts Whselfinvest.de?

Whselfinvest.de Web Server Information

Hosted IP Address:212.24.195.91
Hosted Hostname:212.24.195.91.static.netline.lu
Service Provider:Netline S.A.
Hosted Country:LuxembourgLU
Location Latitude:49.75
Location Longitude:6.167
Webserver Software:Not Applicable

HTTP Header Analysis for Whselfinvest.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: close
Date: Tue, 08 Sep 2015 13:26:42 GMT
Server: Microsoft-IIS/6.0
X-Powered-By: PHP/5.2.1
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-type: text/html


Need to find out who hosts Whselfinvest.de?

Whselfinvest.de Free SEO Report

Website Inpage Analysis for Whselfinvest.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Whselfinvest.de

crcrepublicplattformchandeln ich mchtehandeln ichfrench1returnerffnenlandgalleryactivegallerya 0crctablemitfrtradingdemocraticseminareeinaktienbrokerif directioncfd forex2tradingplattformenkontosiefunctionfuturestradingplattformen gebhrendocumentgetelementbyidgalleryapagedisplayinnerhtmlnewkostenlosemchte wieexpiresdategettime9999togmtstring pathgebhren kontostrategienislandich mchte wiestuttgartichmchteforextradingplattformen gebhren kontogalleryactivegalleryimagevarservice3galleryactivegalleryimage 0npath069if galleryactivegalleryaich mchte einestateskonto erffnenstrctextgalleryactivegalleryasouthdernewcontentifwievar i 04toolsislandsnbspgallerytempgalleryagebhrenmchte eine0ich mchteguineaumdendocumentgetelementbyidgalleryimagepagedisplayinnerhtmltradenunitedstrouttraden ich mchteeinedemozuksaint5handelnstronerrorforvardaxexpiresdategettime9999togmtstringnullcanvastraden ichsehrcfdif galleryactivegalleryimagedirectionstrctextfillstylewebinare

Longtail Keyword Density for Whselfinvest.de

KeywordsOccurences
traden ich mchte10
ich mchte wie6
handeln ich mchte6
trading-plattformen gebhren konto3
var i 03
ich mchte eine3
ich mchte36
traden ich10
mchte wie6
handeln ich6
expiresdategettime9999togmtstring path6
if direction4
galleryactivegallerya 03
if galleryactivegallerya3
mchte eine3
galleryactivegalleryimage 03
trading-plattformen gebhren3
gebhren konto3
konto erffnen3
if galleryactivegalleryimage3
cfd forex3
ich38
mchte36
var26
018
trading15
islands15
traden13
if13
republic13
galleryactivegallerya10
nbsp10
newcontent10
mit9
wie9
galleryactivegalleryimage9
19
kostenlose8
konto8
zu8
function7
futures7
saint7
handeln7
sie7
united6
plattform6
expiresdategettime9999togmtstring6
cfd6
der6
c6
path6
strategien5
forex4
direction4
documentgetelementbyidgalleryapagedisplayinnerhtml4
dax4
island4
24
french4
return4
n4
34
south4
erffnen4
44
strout4
crc4
gallerytempgallerya3
strctextfillstyle3
null3
land3
canvas3
new3
stronerror3
um3
states3
guinea3
sehr3
democratic3
strctext3
documentgetelementbyidgalleryimagepagedisplayinnerhtml3
demo3
gebhren3
trading-plattformen3
fr3
tools3
aktien3
seminare3
webinare3
ein3
den3
service3
0693
broker3
crctable3
forvar3
stuttgart3
53
k3
eine3

What are the nameservers for whselfinvest.de?

Whselfinvest.de Domain Nameserver Information

HostIP AddressCountry
ns1.eurodns.com 204.74.66.130United States United States
ns2.eurodns.com 204.74.110.130United States United States

Whselfinvest.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Whselfinvest.de is a scam?