Wi.gov Favicon Wi.gov

Wi.gov Website Thumbnail
Checking...
Wisconsin.Gov Home
High trust score
 | 
Add a review Change category Claim this site
Wisconsin.gov The Official Website of the State of Wisconsin


Domain summary

Domain label
wi
Domain extension
gov
Global Traffic Rank
2,786
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$5,799,600
Estimated daily income
$5,370
Estimated monthly income
$163,338

Rank summary

How is wi.gov ranked relative to other sites:

Percentage of visits to wi.gov from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wi.gov registered?
A: Wi.gov was registered 3 weeks, 3 days, 1 hour, 58 minutes, 53 seconds ago on Thursday, September 3, 2020.
Q: When was the WHOIS for Wi.gov last updated?
A: The WHOIS entry was last updated 3 weeks, 3 days, 1 hour, 58 minutes, 53 seconds ago on Thursday, September 3, 2020.
Q: What are Wi.gov's nameservers?
A: DNS for Wi.gov is provided by the following nameservers:
  • bigred3.wi.gov
  • bigred.state.wi.us
Q: Who is the registrar for the Wi.gov domain?
A: The domain has been registered at .
Q: What is the traffic rank for Wi.gov?
A: Wi.gov ranks 2,786 globally on Alexa. Wi.gov has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Wi.gov each day?
A: Wi.gov receives approximately 671,213 visitors and 5,369,704 page impressions per day.
Q: What IP address does Wi.gov resolve to?
A: Wi.gov resolves to the IPv4 address 165.189.241.136.
Q: In what country are Wi.gov servers located in?
A: Wi.gov has servers located in the United States.
Q: What webserver software does Wi.gov use?
A: Wi.gov is powered by webserver.
Q: Who hosts Wi.gov?
A: Wi.gov is hosted by State of WI Dept. of Administration in Wisconsin, Madison, United States, 53702.
Q: How much is Wi.gov worth?
A: Wi.gov has an estimated worth of $5,799,600. An average daily income of approximately $5,370, which is roughly $163,338 per month.

Who hosts Wi.gov?

Wi.gov Hosting Provider Information

Hosted IP Address:165.189.241.136
Hosted Hostname:165.189.241.136
Service Provider:State of WI Dept. of Administration
Hosted Country:United StatesUS
Location Latitude:43.0685
Location Longitude:-89.4185
Webserver Software:Not Applicable

Is "State of WI Dept. of Administration" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Wi.gov

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private, max-age=0
Content-Type: text/html; charset=utf-8
Expires: Wed, 19 Aug 2020 01:28:27 GMT
Last-Modified: Thu, 03 Sep 2020 01:28:27 GMT
Server:
X-SharePointHealthScore: 0
X-AspNet-Version:
SPRequestGuid: 123c769f-5d5d-805e-fd47-178f2c34bfb2
request-id: 123c769f-5d5d-805e-fd47-178f2c34bfb2
X-FRAME-OPTIONS: SAMEORIGIN
SPRequestDuration: 68
SPIisLatency: 0
X-WINSource: winsp-pw1
MicrosoftSharePointTeamServices: 16.0.0.4681
X-Content-Type-Options: nosniff
X-MS-InvokeApp: 1; RequireReadOnly
Date: Thu, 03 Sep 2020 01:28:27 GMT
Connection: close
Content-Length: 85230

Wi.gov Domain Nameserver Information

HostIP AddressCountry
bigred3.wi.gov 165.189.56.3United States United States
bigred.state.wi.us 165.189.96.51United States United States


Need to find out who hosts Wi.gov?


WhoIs information for Wi.gov

 % DOTGOV WHOIS Server ready
Domain Name: WI.GOV
Status: ACTIVE

>>> Last update of whois database: 2020-07-07T23:39:07Z

Wi.gov Free SEO Report

Website Inpage Analysis for Wi.gov

H1 Headings

6 :
  1. America's Dairyland
  2. Featured Services
  3. In The News
  4. Directories
  5. Register to Vote at
  6. State Symbols

H2 Headings

8 :
  1. May 18, 2017
  2. At 3.2%, Wisconsin’s Unemployment Rate is the lowest it’s been since February 2000.
  3. May 17, 2017
  4. Governor Walker declares State of Emergency for Barron, Jackson and Rusk counties following tornadoes and damaging storms.
  5. Looking for Wisconsin directories? Whether you're looking for State Agencies, Online Services, or Wisconsin Apps...We've got you covered
  6. Agency Directory
  7. Online Services
  8. Wisconsin Apps

H3 Headings

7 :
  1. Home of dairy farming, cheesemaking, ethnic festivals, polka and the badger. Residents are kindly referred to as Wisconsinites and Cheeseheads. Welcome to Wisconsin.
  2. Badger
  3. Robin
  4. Cheese
  5. Wood Violet
  6. Galena
  7. Dairy Cow

H4 Headings

0 :

H5 Headings

1 :
  1. Governor Tony Evers

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-44130515-2

Links - Internal

24:
  1. Wisconsin.Gov
    http://wi.gov/Pages/Home.aspx
  2. Resident
    http://wi.gov/Pages/resident.aspx
  3. Business
    http://wi.gov/Pages/business.aspx
  4. Visitor
    http://wi.gov/Pages/visitor.aspx
  5. Government
    http://wi.gov/Pages/government.aspx
  6. Workforce
    http://wi.gov/Pages/workforce.aspx
  7. Fishing License
    http://wi.gov/Pages/SearchResults.aspx?q=fishing%20license
  8. Road Construction
    http://wi.gov/Pages/SearchResults.aspx?q=road%20construction
  9. Register a Business
    http://wi.gov/Pages/SearchResults.aspx?q=register%20a%20business
  10. Drivers License
    http://wi.gov/Pages/SearchResults.aspx?q=drivers%20license
  11. launch Agency Directory Primary contact information, agency description, and social media directory for agencies and offices within the State of Wisconsin
    http://wi.gov/Pages/AllAgencies.aspx
  12. resident
    http://wi.gov/Pages/resident.aspx
  13. business
    http://wi.gov/Pages/business.aspx
  14. visitor
    http://wi.gov/Pages/visitor.aspx
  15. government
    http://wi.gov/Pages/government.aspx
  16. workforce directory
    http://wi.gov/Pages/workforce.aspx
  17. launch Wisconsin Apps Looking for information or useful tools on the go? Check out Wisconsin mobile apps that have been developed for our citizens
    http://wi.gov/Pages/MobileApps.aspx
  18. Register to Vote at
    https://myvote.wi.gov/en-us/RegisterToVote
  19. More Wisconsin Symbols
    http://wi.gov/Pages/WisconsinforKids.aspx
  20. Policies
    http://wi.gov/Pages/Policies.aspx
  21. Agencies
    http://wi.gov/Pages/AllAgencies.aspx
  22. Contact Us
    http://wi.gov/Pages/ContactUs.aspx
  23. Credits
    http://wi.gov/Pages/Credits.aspx
  24. No text
    http://wi.gov/Pages/Home.aspx

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. Department of Health Services website
    https://www.dhs.wisconsin.gov/disease/covid-19.htm
  2. inter-agency site
    https://govstatus.egov.com/wi-covid-19

Links - Outbound (nofollow)

0:

Keyword Cloud for Wi.gov

newfileleafrefurlautohyperlink truetitle typebusinesssearchfeaturedvalue 1 featuredcalltoactionorderyourhttpswwwwisconsingovonlinefeaturedmayarialabelcreatedx0020dateifnewpartfieldtype urlresidentfieldtypefieldtype textgovernorfalse allowgridediting0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b8392htmlx0020filex0020typefilex0020typemapcon htmlx0020filex0020typefilex0020typemapicocontenttypefilex0020typemapapp htmlx0020filex0020typefilex0020typemapcon htmlx0020filex0020typefilex0020typemapicoautohyperlinkfeaturedcalltoactionorderroutingruledescriptionpermmaskfilterablefilterable falsefeaturedcalltoactionlinkdesctruefeatured yesstate of wisconsinyoufeaturedcalltoactionimagedescyes featuredvalue 1featuredcalltoactionlinkonline servicesappsidfalse roleresourcesrolecontenttype agencyservicedisplaynamefeaturedvaluerealfieldnamegeturlkeyvaluerootfolderrealfunctioncontenttypeidfilex0020typebooleandescription0 contenttypesortablefeaturedcalltoactiontextalldayeventallowgridediting true namehtmlx0020filex0020typefilex0020typemapicofeaturedcalltoactiondescription ncategoryfalselookingtitle idurl filterable falsetypedisplayname title idfilterable false allowgrideditingcentertrue nameapifilex0020typemapapp7651083c4be2400fb71207881485b32ftext arialabellicenseallowgridediting truenameiftype textinformationnumberfeaturedcalltoactionimagealttextwisconsinsortable false rolefilex0020type filex0020typemapapp htmlx0020filex0020typefilex0020typemapconctxcomputedweb part clickyes featuredvaluehastrue allowgrideditingpropertiestoolshtmlx0020filex0020typefilex0020typemapcon htmlx0020filex0020typefilex0020typemapico icgengifchoicefieldtype text realfieldnameclickagencyservice titlecenter of wisconsinrealfieldname titleviewautohyperlink true allowgrideditingfeaturedvalue 1visitortoolbardatanullallowgridediting1htmlx0020filex0020typefilex0020typemapcontitle displaynameagenciesurl realfieldnamefeaturedcalltoactionimagetext realfieldnamebeen1 featuredcalltoactionordersitecategorylocationurl filterablepart clickfsobjtype 0wisconsingovjobfilex0020type filex0020typemapappvotefilerefcovid19serverfilterrootfoldercreatedx0020dateifnew filerefsortable falseregistertheretype urlfeaturedcalltoactionorder 0contenttype agencyservice title0x30041travel wisconsintravelcurrentrootfoldertopictitlehtmlx0020filex0020typefilex0020typemapico icgengif contenttypeiddisplayname titlehtmlx0020filex0020typefilex0020typemapico icgengiftimeurl arialabelweb parttrue allowgridediting trueicgengif contenttypeideventsicgengif0filex0020typemapapp htmlx0020filex0020typefilex0020typemapconpermmask 0x30041 fsobjtypectxexistingserverfilterhashvarmorerole text arialabelrole url arialabeld1c0586e1fd14d758e2c11f4ddbf3fb8text autohyperlink true20x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b8392 routingruledescriptionrealfieldname title displaynamectxportalurlfsobjtypearialabel title typejob centertext autohyperlinkfeaturedcalltoactiondescriptionagencyservicerole urltype url filterablentrue ifcontenttypeid 0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b8392servicesfieldtype url realfieldnamefsobjtype 0 contenttypestaterole textdairy0 contenttype agencyserviceformattitle displayname titlensdatetimeregister to voteyesdirectory0x30041 fsobjtype 0governmentcalltoactionlinkmultichoicefalse allowgridediting truetype text autohyperlinkcontenttypeid 0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b8392 routingruledescriptiontextspribbonjsfunlaunchnotearialabel titlefeatured yes featuredvalueicgengif contenttypeid 0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b83920x30041 fsobjtypepermmask 0x30041visitfindweb

Longtail Keyword Density for Wi.gov

KeywordsOccurences
allowgridediting true name15
true allowgridediting true8
autohyperlink true allowgridediting7
filterable false allowgridediting7
text autohyperlink true7
type text autohyperlink7
role text arialabel7
fieldtype text realfieldname7
false allowgridediting true6
register to vote5
featuredvalue 1 featuredcalltoactionorder4
yes featuredvalue 14
featured yes featuredvalue4
contenttypeid 0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b8392 routingruledescription4
icgengif contenttypeid 0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b83924
htmlx0020filex0020typefilex0020typemapico icgengif contenttypeid4
htmlx0020filex0020typefilex0020typemapcon htmlx0020filex0020typefilex0020typemapico icgengif4
filex0020typemapapp htmlx0020filex0020typefilex0020typemapcon htmlx0020filex0020typefilex0020typemapico4
filex0020type filex0020typemapapp htmlx0020filex0020typefilex0020typemapcon4
contenttype agencyservice title4
0 contenttype agencyservice4
fsobjtype 0 contenttype4
0x30041 fsobjtype 04
permmask 0x30041 fsobjtype4
web part click4
type url filterable3
role url arialabel3
fieldtype url realfieldname3
state of wisconsin3
realfieldname title displayname3
sortable false role3
arialabel title type3
displayname title id3
title displayname title3
center of wisconsin3
url filterable false3
allowgridediting true18
true name15
web part11
true allowgridediting8
autohyperlink true7
filterable false7
text autohyperlink7
type text7
text arialabel7
role text7
text realfieldname7
fieldtype text7
false allowgridediting7
travel wisconsin5
1 featuredcalltoactionorder5
contenttypeid 0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b83924
0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b8392 routingruledescription4
part click4
permmask 0x300414
0x30041 fsobjtype4
fsobjtype 04
0 contenttype4
contenttype agencyservice4
agencyservice title4
createdx0020dateifnew fileref4
filex0020type filex0020typemapapp4
filex0020typemapapp htmlx0020filex0020typefilex0020typemapcon4
true if4
htmlx0020filex0020typefilex0020typemapcon htmlx0020filex0020typefilex0020typemapico4
featuredcalltoactionorder 04
htmlx0020filex0020typefilex0020typemapico icgengif4
icgengif contenttypeid4
featuredvalue 14
yes featuredvalue4
featured yes4
role url3
fieldtype url3
url arialabel3
type url3
url filterable3
url realfieldname3
online services3
false role3
sortable false3
title type3
arialabel title3
title id3
displayname title3
realfieldname title3
job center3
featuredcalltoactiondescription n3
title displayname3
true44
false41
id29
name22
text22
wisconsin22
var22
displayname20
fieldtype20
allowgridediting20
realfieldname20
type20
role20
arialabel20
018
title15
state15
114
if13
web12
featuredcalltoactionorder12
part11
featured9
url9
featuredcalltoactiontext8
featuredcalltoactionimagealttext8
sitecategory8
featuredcalltoactionlink8
featuredcalltoactionimage8
null8
topic8
featuredcalltoactiondescription8
services8
description8
ctxexistingserverfilterhash8
travel7
filterable7
new7
autohyperlink7
register7
more6
job6
0x300416
ctxportalurl6
currentrootfolder6
click6
fun6
real6
find6
datetime6
ctx6
routingruledescription6
note6
government6
your5
information5
vote5
view5
license5
search5
location4
events4
there4
geturlkeyvaluerootfolder4
serverfilterrootfolder4
time4
featuredcalltoactionlinkdesc4
calltoactionlink4
toolbardata4
24
category4
featuredcalltoactionimagedesc4
httpswwwwisconsingov4
htmlx0020filex0020typefilex0020typemapico4
contenttype4
fileref4
business4
resident4
permmask4
launch4
fsobjtype4
agencyservice4
fileleafref4
featuredvalue4
createdx0020dateifnew4
filex0020type4
filex0020typemapapp4
htmlx0020filex0020typefilex0020typemapcon4
visit4
you4
icgengif4
contenttypeid4
0x01005cca96dadcda214596155bee1bb0463900c7d28829c1d6c94c8cacb8f4ff3b83924
yes4
agencies4
been3
may3
has3
n3
governor3
dairy3
visitor3
alldayevent3
online3
wisconsingov3
choice3
looking3
multichoice3
7651083c-4be2-400f-b712-07881485b32f3
properties3
covid-193
resources3
center3
computed3
api3
ns3
spribbonjs3
format3
function3
tools3
sortable3
boolean3
number3
directory3
apps3
d1c0586e-1fd1-4d75-8e2c-11f4ddbf3fb83

Wi.gov Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wi.gov is a scam?

Websites with Similar Names

Wi-attorneys.com
Family Attorneys - Minneapolis and St. Paul, MN - Wellner and Isaacson PLLP
Wi-atty.com
Firm Overview | Zerbst & Kluck
Wi-autos.com
Buick, Cadillac, Chevrolet, Chrysler, Dodge, Ford, GMC, Hyundai, Jeep, Kia, Lincoln, Mazda, Nissan, RAM, Volkswagen Dealership Milwaukee WI | Pre-Owned Cars Boucher Auto Group
Wi-bell.com
Wi-Bell | The Smart Video Intercom that can . . .
Wi-biz.co
WI-biz.co

Recently Updated Websites

Hathawaylaw.net 1 second ago.Brisbaneacfe.org 2 seconds ago.Hibakodolvasas.com 2 seconds ago.Taylormetal.com 3 seconds ago.Dssytems.com 3 seconds ago.Ezyquotes.com 4 seconds ago.Wotmin.com 5 seconds ago.Supergirlforreal.com 5 seconds ago.Reteshopping.com 5 seconds ago.Spectrumknowledge.com 5 seconds ago.Pechnoi.ru 5 seconds ago.Cbtelevision.com.mx 5 seconds ago.Sadayeafghan.com 6 seconds ago.Rsghunt.com 6 seconds ago.Austinlandes.com 7 seconds ago.Firecat451.com 7 seconds ago.Smokyhillsart.com 9 seconds ago.Frogpeak.org 9 seconds ago.Nightsite.info 9 seconds ago.Ayg.cc 9 seconds ago.Therivertribe.net 10 seconds ago.Onlinemoneymaker.club 10 seconds ago.Rctackle.com 10 seconds ago.Pcaworldwide.com 10 seconds ago.Cdeofbr.com 10 seconds ago.Awards4u.ca 10 seconds ago.Thespringsla.com 10 seconds ago.Panstep.com.ua 11 seconds ago.Speed-tester.info 11 seconds ago.Signalng.com 12 seconds ago.