Wikipedia.org Review - Wikipedia551
Wikipedia.org
5 out of 5 based on 1 user ratings.

Wikipedia.org Website Analysis Summary

Wikipedia.org  |  Wikipedia
High trust score  | 
Wikipedia is a free online encyclopedia, created and edited by volunteers around the world and hosted by the Wikimedia Foundation.


Rank
12
Rating
A++
Trust Score
High trust score
Estimated worth
$1,346,400,360
Estimated daily income
$1,246,667
Estimated monthly income
$37,919,455
Backlinks
0

Wikipedia.org has a High trust score, and a Statvoo Rank of A++.

Wikipedia.org is hosted by Wikimedia Foundation, Inc. in Netherlands.
Wikipedia.org has an IP Address of 91.198.174.192 and a hostname of text-lb.esams.wikimedia.org and runs ATS/8.0.5 web server.

The domain wikipedia.org was registered 1 decade 9 years 1 month ago by Public Interest Registry, it was last modified 1 month 2 days 27 minutes ago and currently is set to expire 1 month 2 days 27 minutes ago.

It is the world's 12 most popular site among over 300 million websites.

Wikipedia.org has a total of 0 backlinks.

Wikipedia.org gets approximately 155,833,333 unique visitors a day and 1,246,666,664 pageviews per day.

Wikipedia.org has an estimated worth of $1,346,400,360.
An average daily income of approximately $1,246,667, which is wroughly $37,919,455 per month.

Whois information for wikipedia.org

Full Whois Lookup for Wikipedia.org Whois Lookup

Domain Name: WIKIPEDIA.ORG
Registry Domain ID: D51687756-LROR
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2015-12-12T10:16:19Z
Creation Date: 2001-01-13T00:12:14Z
Registry Expiry Date: 2023-01-13T00:12:14Z
Registrar Registration Expiration Date:
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Wikimedia Foundation, Inc.
Registrant State/Province: CA
Registrant Country: US
Name Server: NS0.WIKIMEDIA.ORG
Name Server: NS1.WIKIMEDIA.ORG
Name Server: NS2.WIKIMEDIA.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-01-23T12:10:32Z

Who hosts Wikipedia.org?

Wikipedia.org Web Server Information

Hosted IP Address:91.198.174.192
Hosted Hostname:text-lb.esams.wikimedia.org
Service Provider:Wikimedia Foundation, Inc.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:ATS/8.0.5

HTTP Header Analysis for Wikipedia.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 23 Jan 2020 08:17:25 GMT
Cache-Control: s-maxage=86400, must-revalidate, max-age=3600
Server: ATS/8.0.5
X-ATS-Timestamp: 1579767445
ETag: W/"12be8-59c0633ed3519"
Content-Type: text/html
Last-Modified: Mon, 13 Jan 2020 14:22:18 GMT
Backend-Timing: D=313 t=1579087395644522
Content-Encoding: gzip
Vary: Accept-Encoding
X-Varnish: 284583222 1039050401
Age: 14046
X-Cache: cp3062 miss, cp3056 hit/209131
X-Cache-Status: hit-front
Server-Timing: cache;desc="hit-front"
Strict-Transport-Security: max-age=106384710; includeSubDomains; preload
X-Client-IP: 116.203.74.96
Accept-Ranges: bytes
Content-Length: 18800
Connection: keep-alive

Need to find out who hosts Wikipedia.org?

Wikipedia.org Free SEO Report

Website Inpage Analysis for Wikipedia.org

H1 Headings:1
Wikipedia The Free Encyclopedia
H2 Headings:5
1 000 000+ articles
100 000+ articles
10 000+ articles
1 000+ articles
100+ articles
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:1
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Wikipedia.org

yourportugusarticlessloveninawikipediafreepageenglishdeutschfranaispolskiitalianobasaespaolbahasaamp

Longtail Keyword Density for Wikipedia.org

KeywordsOccurences
free11
articles8
wikipedia6
english5
bahasa5
slovenina4
your4
page4
deutsch3
espaol3
franais3
italiano3
portugus3
polski3
basa3
amp3

What are the nameservers for wikipedia.org?

Wikipedia.org Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown