Wimdu - Vacation Rentals & City Apartments Worldwide

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Find accommodations worldwide on Wimdu ✔ Choose from over 350,000 vacation rentals starting at just $13/night ✔ Save up to 65% by booking with Wimdu today ✔



Domain summary

Last updated
2020-12-08
Domain label
wimdu
Domain extension
com.pe
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is wimdu.com.pe ranked relative to other sites:

Percentage of visits to wimdu.com.pe from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wimdu.com.pe registered?
A: Wimdu.com.pe was registered 4 months, 1 week, 2 days, 1 hour, 48 minutes, 58 seconds ago on Tuesday, December 8, 2020.
Q: When was the WHOIS for Wimdu.com.pe last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 2 days, 1 hour, 48 minutes, 58 seconds ago on Tuesday, December 8, 2020.
Q: What are Wimdu.com.pe's nameservers?
A: DNS for Wimdu.com.pe is provided by the following nameservers:
  • ns1.is-fun.net
  • ns2.is-fun.net
Q: Who is the registrar for the Wimdu.com.pe domain?
A: The domain has been registered at .
Q: What is the traffic rank for Wimdu.com.pe?
A: Wimdu.com.pe has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Wimdu.com.pe each day?
A: Wimdu.com.pe receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Wimdu.com.pe resolve to?
A: Wimdu.com.pe resolves to the IPv4 address 212.114.33.35.
Q: In what country are Wimdu.com.pe servers located in?
A: Wimdu.com.pe has servers located in the Germany.
Q: What webserver software does Wimdu.com.pe use?
A: Wimdu.com.pe is powered by Nginx webserver.
Q: Who hosts Wimdu.com.pe?
A: Wimdu.com.pe is hosted by TelemaxX Telekommunikation GmbH in Germany.
Q: How much is Wimdu.com.pe worth?
A: Wimdu.com.pe has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Wimdu.com.pe Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wimdu.com.pe Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wimdu.com.pe

H1 Headings

1 :
  1. For Those Unforgettable Holiday Memories – Book Vacation Apartments with Wimdu

H2 Headings

2 :
  1. OUR TOP DESTINATIONS
  2. Finding the Right Accommodation For You

H3 Headings

58 :
  1. Resort
  2. 400 ft² Resort
  3. Resort
  4. House
  5. Resort
  6. 1320 ft² Condo
  7. 1320 ft² House
  8. 330 ft² Cabin
  9. Villa
  10. Cabin
  11. 1590 ft² Condo
  12. Cabin
  13. House
  14. 450 ft² Cabin
  15. House
  16. 1850 ft² House
  17. Cabin
  18. 1230 ft² House
  19. House
  20. 1190 ft² Condo
  21. House
  22. 1030 ft² House
  23. Cabin
  24. Cabin
  25. Apartment
  26. Apartment
  27. Apartment
  28. Cabin
  29. Apartment
  30. Cabin
  31. 740 ft² House
  32. 420 ft² Cabin
  33. 1990 ft² House
  34. Resort
  35. 2100 ft² House
  36. 1180 ft² Condo
  37. House
  38. House
  39. House
  40. Farmhouse
  41. Cabin
  42. Resort
  43. Cabin
  44. 990 ft² Cabin
  45. Cabin
  46. Cabin
  47. Apartment
  48. Resort
  49. Popular cities
  50. Popular holiday destinations
  51. Browse by country
  52. Discover London
  53. Amsterdam
  54. Hong Kong
  55. Rio de Janeiro
  56. Copenhagen
  57. CROATIA
  58. All countries

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

57 :

Google Adsense

:
pub-2065291527898394

Google Analytics

:
UA-45666214-1

Links - Internal (nofollow)

0:

Links - Outbound

83:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wimdu.com.pe

you can bookidaho united19100 quotexcellentquotfavoritebookcarolina unitedreviewsstarmessageaverage rating 38washington unitedproviderssouthguestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage ratingper night cabin50 outtennessee united statesyour bookingpmratinghas been23parttosoffers from wimdudatesnumberstates 94hawaiimount2 guestsprovidergetprivacypleasevacasawimdustringworldscalifornia unitedyou wantquotexcellentquot 1 reviewguestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaveragestoriesavailable5strikedpricetitlehousetooltipsredirectbookinquirycounty texas unitedreceiving our weeklyfindapplyreadvarhongrentalsunited states 100county washington unitedviabooking you canusersread the termsrangeroomweekly email newslettervacation rentalsweeks 21bookingprivacypolicylinkfunctioncan findftu00b2 housetooltipsredirectbookavailabilityfull90 quotoutstandingquotchoose82 quotvery80 quotvery goodquotsenttravelservicebesthappydataover1inf countemail newsletter fullthere are noproviderchoose actualbedroomcheckpricefalsediscounttooltiph1resorth2endtrail clark countysavedvacatiaweekshouseh2endtrailglobaltripperflorida united states1directly without9wereceiveweredeals viaarrivalalreadycounty tennesseeconfirm yourrating 50experience80 quotveryour parttosresortthemwithoutstaywellapplicablelatesttexas unitedinf countdestinationsnoour weeklyguestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelveryquotgoodquotexcitingstill haveresort mount charlestonmaywrongno resultsdates to getcabinrating 40nevada4ft condotopunited states 80charleston clarkweek 14dealspaymentrightcounty148night resortbearmount charlestoncounty colorado5strikedpricetitleapartmenttooltipsredirectbookvacasa websitemethodinstantvalidstates 90 quotoutstandingquotquotexcellentquotvacatia websitemethodinstanthaving to inquirepricepleaserating 38north carolina unitedout of 5strikedpricetitlecabintooltipsredirectbooklanguages englishyou for your0county californialikeft5strikedpricetitlecabintooltipsredirectbookduringallowshotrequestchargeshomeemail addressyou cancelangeles california unitedholidayflorida unitedup younight cabinback to youquotveryoffer directlycabintooltipsredirectbook this offercookiesvia emailwishguestsproviderget40 outaccommodationsfarmsstillprevious76 quotgoodquotaccommodationwithout havingofferhousetooltipsredirectbook this offerreservationempire businessstates 76washington united statessevier county tennessee5strikedpricetitleresorttooltipsredirectbook this offercallselectfewerrating 47showsper night houseactual arrivalclark20cannotdeparture datescan bookinquirepriceplease choose actualtripcancel your reservationunited states 94charlestoncharleston clark countydirectly without havingstates 76 quotgoodquotresultsstates 82mount charleston clarkreceive offersyouusedbookedcabinh2endtrailifgothong kongwimdu and ournevada unitedgoodstars4category3messagevalue82starmessageaverage rating 41exclusive dealsbedroomcheckpricefalsediscounttooltiph1resorth2endtrailinfquotoutstandingquotislandhavingfind yourprice22getreviews1 nightglobaltripper websitemethodinstant bookinginquirepricepleasevaluecarolinanight 7agree21county idaho unitedrating 41ourexclusive offersapply please readempireweeklybusinessyou canthese1 week 14morecondoh2endtrailout of 5strikedpricetitleresorttooltipsredirectbookunited states 82newsletter fullothercan15per nightmore accurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelverycruzft housemore accurate47 outsorryyou cancel yourrating 45 out18statesstarttrailmountper night resortnight resort mountcounty nevada united1 weekidahocountwebsitemethodinstant booking youreviewsstarmessageaverage rating2county nevadaangelesweekly emailsevierweek 2 guestsprovidergetchoose actual arrivalkongreviewsstarmessageaverage rating 40receivingnaplesstates 82 quotverylakevacationft cabinresort mounterror1 week 2freesoallows usexpedia websitemethodinstant bookingthereonlyowntouchfarms empire businesslistsstates 80popularftu00b2 condotooltipsredirectbookbelowsecurestatesfriget morewashingtonwantagain41 outcounty idahoexpediasantamynorth carolinashows offersrentalcancel yourfeetennesseecounty texasbeachesusbetweenbutinquirepriceplease choose45 outreviewstarmessageaverage ratingguests1026whichsigningfarms empiretravel dateslos angelesplease trybedroomcheckpricefalsediscounttooltiph1resorth2endtrail clarkreceiving our1 night 7rating 38 outherealaska united states117price persigning up youreduced pricedirectlyupget backoldcancellationtimeexpedia websitemethodinstantadditionalanyget a roomperfectcustomer serviceshowlivehousetooltipsredirectbookhave17condotooltipsredirectbookhtggaoptoutstates 90actual1infcondotooltipsredirectbook this offercondosettingsquotexcellentquot 1messagefloridaveryplacessatroom websitemethodinstantcounty washingtonplease readsanpartnerpricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelveryagree to our2 weeksget more accuratemay apply pleaseftu00b21 infdurationclark countynewunited statesstarttrailmounttennessee unitedvacasa websitemethodinstant bookingalsowebsitemethodinstanthave anymarketingapartmentcaliforniaonefire islandyourunited states 90departuredounited statestexasweekftu00b2 condoh2endtrailmost82 quotvery goodquotyou havewebsitemethodinstant bookingarrival and departurecitynightnextper night apartmentyour perfect1 reviewnotsanta cruzangeles californiauserhasoffer directly withouttrendshotelsyou likefoundtruesearch12reviewsstarmessageaverage rating 50sevier countyyour travelbackquestions5strikedpricetitlehousetooltipsredirectbook this offertryyour reservation2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelveryftu00b2 househ2endtrailreducedyou will receiverating 40 outhawaii unitedbook this offeryou agreemay applyour weekly emailcalifornia united statescustomerconfirmrating 50 outvacatia websitemethodinstant bookingoutwentstates 100 quotexcellentquotreviewreviewsstarmessageaverage rating 45booking youglobaltripper websitemethodinstantpartners2 weeks 21beenpartpolicyaccurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelverycounty tennessee unitedroom websitemethodinstant bookingcounty colorado unitedlatest trendsinformationnight apartmentcolorado unitedusemightapartmentsreviewsstarmessageaverageunitedfireapply pleaseour privacypolicylink24checkcostsclark county nevadacounty california united94 quotoutstandingquotlos angeles california5strikedpricetitleresorttooltipsredirectbookrating 47 outnot a validemail newsletteralaskadeals via emailstates 100tips38 outnewsletter16ftu00b2 cabinh2endtrailemail2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaveragegoodstars4category3messagevalue82starmessageaverage ratingconditionsgoodstars4category3messagevalue82starmessageaveragedetailscancelalaska unitedupcomingperoffersnight housegoodftu00b2 cabintooltipsredirectbooklosyorkyour vacationexclusivequotvery goodquotcabintooltipsredirectbook5strikedpricetitlecabintooltipsredirectbook this offerrating 41 outenglishgoodquot5strikedpricetitleapartmenttooltipsredirectbook this offerdateseenorthreviewstarmessageaveragenew york6states 80 quotveryaccuratesunplaceweek 2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelverynevada united statesstarttrailmount25out of 5strikedpricetitlehousetooltipsredirectbookallup you agreestates 94 quotoutstandingquothousemexicocity apartmenthelptermsmakecontactinf numberrating 45languagessigning upwebsitescreateyour favoriteaddressproperty13united states 765bedroomscheckpricefalsediscounttooltiph1cabinh2endtrailout of 5strikedpricetitleapartmenttooltipsredirectbook3parkgalvestonweek 2francecarolina united statesnevada united statessundaycoloradocheckindifferent

Longtail Keyword Density for Wimdu.com.pe

KeywordsOccurences
book this offer48
dates to get48
1 week 248
websitemethodinstant booking you48
booking you can48
you can book48
offer directly without48
directly without having48
having to inquirepriceplease48
inquirepriceplease choose actual48
choose actual arrival48
arrival and departure48
get more accurate48
expedia websitemethodinstant booking33
per night cabin11
5strikedpricetitlecabintooltipsredirectbook this offer10
out of 5strikedpricetitlecabintooltipsredirectbook10
county nevada united8
county tennessee united8
clark county nevada8
per night house8
housetooltipsredirectbook this offer7
united states 1007
rating 50 out7
states 100 quotexcellentquot7
5strikedpricetitlehousetooltipsredirectbook this offer6
out of 5strikedpricetitlehousetooltipsredirectbook6
5strikedpricetitleresorttooltipsredirectbook this offer6
out of 5strikedpricetitleresorttooltipsredirectbook6
rating 41 out6
per night resort6
82 quotvery goodquot6
county washington united6
united states 826
states 82 quotvery6
sevier county tennessee6
county california united6
california united states6
rating 45 out5
reviewsstarmessageaverage rating 505
rating 40 out5
florida united states5
per night apartment5
vacasa websitemethodinstant booking5
reviewsstarmessageaverage rating 454
agree to our4
county idaho united4
tennessee united states4
united states 764
north carolina united4
up you agree4
condotooltipsredirectbook this offer4
county texas united4
you will receive4
county colorado united4
nevada united states4
united states 804
states 80 quotvery4
goodstars4category3messagevalue82starmessageaverage rating 414
cabintooltipsredirectbook this offer4
signing up you4
80 quotvery goodquot4
angeles california united4
los angeles california4
apply please read3
globaltripper websitemethodinstant booking3
5strikedpricetitleapartmenttooltipsredirectbook this offer3
1 night 73
may apply please3
our weekly email3
1 week 143
2 weeks 213
not a valid3
receiving our weekly3
weekly email newsletter3
email newsletter full3
you for your3
offers from wimdu3
wimdu and our3
there are no3
deals via e-mail3
back to you3
you cancel your3
cancel your reservation3
out of 5strikedpricetitleapartmenttooltipsredirectbook3
alaska united states3
rating 38 out3
night resort mount3
states 76 quotgoodquot3
farms empire business3
carolina united states3
bedroomcheckpricefalsediscounttooltiph1resorth2endtrail clark county3
nevada united statesstarttrailmount3
week 2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery3
2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage3
guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage rating3
washington united states3
vacatia websitemethodinstant booking3
quotexcellentquot 1 review3
states 94 quotoutstandingquot3
reviewsstarmessageaverage rating 383
united states 943
states 90 quotoutstandingquot3
united states 903
more accurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelvery3
week 2 guestsproviderget3
get a room3
room websitemethodinstant booking3
rating 47 out3
charleston clark county3
mount charleston clark3
reviewsstarmessageaverage rating 403
resort mount charleston3
read the terms3
you can55
1 week53
united states50
more accurate50
per night49
week 248
offer directly48
actual arrival48
without having48
departure dates48
directly without48
get more48
websitemethodinstant booking48
can book48
choose actual48
booking you48
inquirepriceplease choose48
expedia websitemethodinstant33
reviewsstarmessageaverage rating28
quotvery goodquot14
california united12
night cabin11
florida united10
tennessee united8
inf count8
county tennessee8
night house8
nevada united8
county nevada8
clark county8
your booking8
vacation rentals7
states 1007
100 quotexcellentquot7
ftu00b2 househ2endtrail7
50 out7
ftu00b2 housetooltipsredirectbook7
rating 507
ft house7
41 out6
county california6
night resort6
states 826
82 quotvery6
please try6
sevier county6
carolina united6
rating 416
alaska united6
washington united6
county washington6
los angeles5
1 review5
have any5
vacasa websitemethodinstant5
rating 405
you have5
reviewstarmessageaverage rating5
45 out5
night apartment5
rating 455
40 out5
confirm your4
ftu00b2 cabinh2endtrail4
ftu00b2 condotooltipsredirectbook4
ftu00b2 condoh2endtrail4
signing up4
up you4
you agree4
exclusive deals4
ftu00b2 cabintooltipsredirectbook4
travel dates4
80 quotvery4
ft condo4
ft cabin4
county texas4
texas united4
fire island4
new york4
states 804
goodstars4category3messagevalue82starmessageaverage rating4
states 764
cancel your4
county idaho4
idaho united4
county colorado4
colorado united4
hawaii united4
find your4
you like4
inf number4
north carolina4
angeles california4
you want3
exclusive offers3
receiving our3
our weekly3
please read3
weekly email3
our privacypolicylink3
email newsletter3
newsletter full3
reduced price3
latest trends3
price per3
apply please3
may apply3
your reservation3
our parttos3
receive offers3
no results3
1inf count3
you cancel3
get back3
allows us3
your perfect3
via e-mail3
deals via3
your travel3
1 inf3
still have3
city apartment3
weeks 213
76 quotgoodquot3
shows offers3
customer service3
your vacation3
hong kong3
santa cruz3
empire business3
farms empire3
quotexcellentquot 13
bedroomcheckpricefalsediscounttooltiph1resorth2endtrail clark3
94 quotoutstandingquot3
states 943
90 quotoutstandingquot3
states 903
charleston clark3
mount charleston3
resort mount3
languages english3
united statesstarttrailmount3
2 weeks3
38 out3
week 143
night 73
1 night3
has been3
your favorite3
can find3
globaltripper websitemethodinstant3
rating 383
2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery3
47 out3
rating 473
room websitemethodinstant3
2 guestsproviderget3
accurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelvery3
vacatia websitemethodinstant3
guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage3
email address3
0131
you115
offer101
united100
your78
more65
can64
booking62
get59
dates58
county58
155
week53
per53
accurate52
night52
book50
choose50
without50
states50
having49
inquirepriceplease48
departure48
arrival48
websitemethodinstant48
actual48
directly48
rating41
out41
expedia33
guests32
our32
ftu00b232
reviews31
count28
reviewsstarmessageaverage28
wimdu23
have21
offers19
travel17
inf16
all16
ft16
city16
available16
new16
us15
vacation15
cabin15
house15
please15
we15
price14
email14
quotvery14
goodquot14
no13
florida13
california12
property11
up11
find11
quotexcellentquot11
deals10
5strikedpricetitlecabintooltipsredirectbook10
receive10
rentals10
not10
exclusive9
quotoutstandingquot9
review9
weeks9
29
any8
service8
but8
accommodation8
terms8
apartment8
see8
clark8
cookies8
use8
nevada8
tennessee8
37
do7
resort7
read7
47
57
if7
via7
67
househ2endtrail7
information7
housetooltipsredirectbook7
76
number6
perfect6
86
5strikedpricetitleresorttooltipsredirectbook6
stay6
experience6
like6
var6
5strikedpricetitlehousetooltipsredirectbook6
one6
rental6
alaska6
results6
96
wish6
carolina6
quotgoodquot6
already6
mount6
try6
1inf6
sevier6
partner6
washington6
stories6
105
here5
upcoming5
found5
create5
during5
115
reviewstarmessageaverage5
date5
select5
cancellation5
pm5
york5
island5
fire5
providers5
customer5
los5
angeles5
might5
has5
marketing5
vacasa5
search5
best5
full5
also5
different5
free5
charleston5
bedroomscheckpricefalsediscounttooltiph1cabinh2endtrail5
help5
hawaii5
125
make5
latest4
want4
sent4
cannot4
134
room4
good4
costs4
partners4
applicable4
contact4
signing4
agree4
them4
condoh2endtrail4
cabintooltipsredirectbook4
cabinh2endtrail4
hotels4
show4
condotooltipsredirectbook4
fewer4
duration4
confirm4
place4
colorado4
144
allows4
reduced4
apartments4
cancel4
texas4
154
may4
own4
most4
164
conditions4
mexico4
payment4
goodstars4category3messagevalue82starmessageaverage4
south4
questions4
only4
174
e-mail4
booked4
user4
north4
previous4
condo4
idaho4
saved4
address4
old4
next4
true4
privacy4
santa4
these4
got4
san4
184
trip3
provider3
accommodations3
websites3
below3
there3
partpolicy3
parttos3
used3
call3
places3
still3
193
touch3
error3
between3
went3
wrong3
data3
my3
sorry3
back3
happy3
reservation3
fee3
value3
apply3
charges3
settings3
privacypolicylink3
users3
availability3
so3
guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery3
check3
over3
live3
worlds3
exciting3
hong3
kong3
beaches3
home3
holiday3
very3
secure3
right3
time3
well3
range3
france3
popular3
htggaoptout3
top3
203
213
bear3
lake3
223
galveston3
233
destinations3
park3
farms3
empire3
business3
cruz3
hot3
naples3
function3
sunday3
trends3
243
favorite3
details3
inquiry3
message3
been3
other3
valid3
again3
check-in3
string3
tips3
receiving3
weekly3
newsletter3
lists3
request3
fri3
bedroomcheckpricefalsediscounttooltiph1resorth2endtrail3
sat3
sun3
shows3
which3
languages3
english3
statesstarttrailmount3
were3
vacatia3
pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelvery3
guestsproviderget3
253
263
5strikedpricetitleapartmenttooltipsredirectbook3
globaltripper3
additional3

Who hosts Wimdu.com.pe?

Wimdu.com.pe Hosting Provider Information

Hosted IP Address:212.114.33.35
Hosted Hostname:ger13-2.wwwserver.net
Service Provider:TelemaxX Telekommunikation GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "TelemaxX Telekommunikation GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
TelemaxX Telekommunikation GmbH
0.0075%

HTTP Header Analysis for Wimdu.com.pe

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Server: nginx
Content-Type: text/html; charset=UTF-8
Cache-Control: private, must-revalidate
Strict-Transport-Security: max-age=31536000; includeSubDomains
pragma: no-cache
expires: -1
X-Frame-Options: sameorigin
Content-Encoding: gzip
Accept-Ranges: bytes
Date: Tue, 08 Dec 2020 14:41:01 GMT
Via: 1.1 varnish
X-Served-By: cache-lon4235-LON
X-Cache: MISS
X-Cache-Hits: 0
X-Timer: S1607438461.477041,VS0,VE174
Vary: Accept-Encoding, Accept-Encoding
transfer-encoding: chunked

Wimdu.com.pe Domain Nameserver Information

HostIP AddressCountry
ns1.is-fun.net 212.114.35.78
ns2.is-fun.net 192.174.68.100


Need to find out who hosts Wimdu.com.pe?


Domain Registration (WhoIs) information for Wimdu.com.pe

 Domain Name: wimdu.com.pe
WHOIS Server: NIC .PE
Sponsoring Registrar: InterNetX GmbH
Domain Status: ok
Registrant Name: Stevan Lutz
Admin Name: Stevan Lutz
Admin Email: Login to show email
Server: ns1.is-fun.net
Name Server: ns2.is-fun.net
DNSSEC: unsigned
>>> Last update of WHOIS database: 2020-12-08T14:37:43.282Z

Recently Updated Websites

Hireavcompany.com (1 second ago.)Newpartgroup.com (2 seconds ago.)Scubainkllc.com (2 seconds ago.)Traceylogistics.online (2 seconds ago.)Mail-goebel.net (2 seconds ago.)Shoplimelyte.com (2 seconds ago.)Writersblock.net (3 seconds ago.)Veluwsegolfclub.info (3 seconds ago.)Dealfetchr.com (3 seconds ago.)Southwesternglass.com (3 seconds ago.)Inczenenext.com (3 seconds ago.)Genevievechristophe.com (3 seconds ago.)Redarrowcanoes.com (3 seconds ago.)Bibsoc.org.uk (3 seconds ago.)Addicted2kite.com (4 seconds ago.)Cgm1992.com (4 seconds ago.)Ripoxy.com (4 seconds ago.)Sjhomesonline.com (4 seconds ago.)Perezalati.com (4 seconds ago.)Arkansasmedicareinsurance.com (4 seconds ago.)Homenirmaan.com (4 seconds ago.)Raisingsomeoneelseschild.info (4 seconds ago.)Homevlad.ru (4 seconds ago.)Funerais.com (4 seconds ago.)Dbti.com.br (4 seconds ago.)Vbm.se (4 seconds ago.)Skincarequeencolleen.com (5 seconds ago.)Mobilefusionsoft.com (5 seconds ago.)Insurancecpa.info (5 seconds ago.)Namathunews.com (5 seconds ago.)

Recently Searched Keywords

biologische (2 seconds ago.)металлообработка высокоточные работы по резке, рубке, гибке, сверлению, и цинкованию металлопродукции. (3 seconds ago.)bobty807 (5 seconds ago.)металлообработка высокоточные работы по резке, рубке, гибке, сверлению, и цинкованию металлопродукции. (5 seconds ago.)get info and discount (6 seconds ago.)missionaries (10 seconds ago.)career war leaders (13 seconds ago.)at&t q3 review: better than expected earnings quell investor fears, but for how long (17 seconds ago.)tdb-logo-svg-wrap (22 seconds ago.)sex doll fuck (23 seconds ago.)gospel preaching images (23 seconds ago.)non-toxic insect solutions (25 seconds ago.)đau bụng dưới rốn là dấu hiệu của bệnh lý gì, có nguy hiểm không (26 seconds ago.)toolscake decorating moldsmats (27 seconds ago.)pix daddy young (28 seconds ago.)vedi tutti gli sponsor (32 seconds ago.)pippa funnell 2 - farm adventures (yhzp) (32 seconds ago.)onlive (36 seconds ago.)mheshimiwa (37 seconds ago.)watch steven universe online (40 seconds ago.)koraalspechtcity (42 seconds ago.)đau bụng dưới rốn là dấu hiệu của bệnh lý gì, có nguy hiểm không (43 seconds ago.)buddypress compatible (45 seconds ago.)media player for windows (48 seconds ago.)if console (50 seconds ago.)you cannbspnbspnbsp (52 seconds ago.)[email protected] (53 seconds ago.)tcil is observing vigilance awareness week- 2019 from 28th october to 2nd november, 2019 (55 seconds ago.)tietkiemnhienlieu (1 minute 2 seconds ago.)social media wellbeing (1 minute 3 seconds ago.)