Wimdu.com.peWimdu.com.pe

Wimdu - Vacation Rentals & City Apartments Worldwide

Safety: Low trust score

Year Founded: 2020

Global Traffic Rank: Unknown

Estimated Worth: $9

Category: This site has not been categorized yet

Expand details Add category Claim this site

Find accommodations worldwide on Wimdu ✔ Choose from over 350,000 vacation rentals starting at just $13/night ✔ Save up to 65% by booking with Wimdu today ✔

wimdu

Domain summary

Last updated	2020-12-08
Domain label	wimdu
Domain extension	com.pe
Global Traffic Rank	0
Statvoo Rating	I
Trust Score	Low Trust Score
Estimated worth	$9
Estimated daily income	$0
Estimated monthly income	$0

Rank summary

How is wimdu.com.pe ranked relative to other sites:

Percentage of visits to wimdu.com.pe from a search engine:

Frequently Asked Questions (FAQ)

Q: When was Wimdu.com.pe registered?

A: Wimdu.com.pe was registered 4 months, 1 week, 2 days, 1 hour, 48 minutes, 58 seconds ago on Tuesday, December 8, 2020.

Q: When was the WHOIS for Wimdu.com.pe last updated?

A: The WHOIS entry was last updated 4 months, 1 week, 2 days, 1 hour, 48 minutes, 58 seconds ago on Tuesday, December 8, 2020.

Q: What are Wimdu.com.pe's nameservers?

A: DNS for Wimdu.com.pe is provided by the following nameservers:

ns1.is-fun.net
ns2.is-fun.net

Q: Who is the registrar for the Wimdu.com.pe domain?

A: The domain has been registered at .

Q: What is the traffic rank for Wimdu.com.pe?

A: Wimdu.com.pe has a Low Trust Score, and a Statvoo Rank of I.

Q: How many people visit Wimdu.com.pe each day?

A: Wimdu.com.pe receives approximately 0 visitors and 0 page impressions per day.

Q: What IP address does Wimdu.com.pe resolve to?

A: Wimdu.com.pe resolves to the IPv4 address 212.114.33.35.

Q: In what country are Wimdu.com.pe servers located in?

A: Wimdu.com.pe has servers located in the Germany.

Q: What webserver software does Wimdu.com.pe use?

A: Wimdu.com.pe is powered by Nginx webserver.

Q: Who hosts Wimdu.com.pe?

A: Wimdu.com.pe is hosted by TelemaxX Telekommunikation GmbH in Germany.

Q: How much is Wimdu.com.pe worth?

A: Wimdu.com.pe has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Wimdu.com.pe Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wimdu.com.pe Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wimdu.com.pe

H1 Headings

1 :

For Those Unforgettable Holiday Memories – Book Vacation Apartments with Wimdu

H2 Headings

2 :

OUR TOP DESTINATIONS
Finding the Right Accommodation For You

H3 Headings

58 :

Resort
400 ft² Resort
Resort
House
Resort
1320 ft² Condo
1320 ft² House
330 ft² Cabin
Villa
Cabin
1590 ft² Condo
Cabin
House
450 ft² Cabin
House
1850 ft² House
Cabin
1230 ft² House
House
1190 ft² Condo
House
1030 ft² House
Cabin
Cabin
Apartment
Apartment
Apartment
Cabin
Apartment
Cabin
740 ft² House
420 ft² Cabin
1990 ft² House
Resort
2100 ft² House
1180 ft² Condo
House
House
House
Farmhouse
Cabin
Resort
Cabin
990 ft² Cabin
Cabin
Cabin
Apartment
Resort
Popular cities
Popular holiday destinations
Browse by country
Discover London
Amsterdam
Hong Kong
Rio de Janeiro
Copenhagen
CROATIA
All countries

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

57 :

Google Adsense

pub-2065291527898394

Google Analytics

UA-45666214-1

Links - Internal

Show 1 more items

Links - Internal (nofollow)

Links - Outbound

83:

Show 78 more items

Links - Outbound (nofollow)

Keyword Cloud for Wimdu.com.pe

you can bookidaho united19100 quotexcellentquotfavoritebookcarolina unitedreviewsstarmessageaverage rating 38washington unitedproviderssouthguestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage ratingper night cabin50 outtennessee united statesyour bookingpmratinghas been23parttosoffers from wimdudatesnumberstates 94hawaiimount2 guestsprovidergetprivacypleasevacasawimdustringworldscalifornia unitedyou wantquotexcellentquot 1 reviewguestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaveragestoriesavailable5strikedpricetitlehousetooltipsredirectbookinquirycounty texas unitedreceiving our weeklyfindapplyreadvarhongrentalsunited states 100county washington unitedviabooking you canusersread the termsrangeroomweekly email newslettervacation rentalsweeks 21bookingprivacypolicylinkfunctioncan findftu00b2 housetooltipsredirectbookavailabilityfull90 quotoutstandingquotchoose82 quotvery80 quotvery goodquotsenttravelservicebesthappydataover1inf countemail newsletter fullthere are noproviderchoose actualbedroomcheckpricefalsediscounttooltiph1resorth2endtrail clark countysavedvacatiaweekshouseh2endtrailglobaltripperflorida united states1directly without9wereceiveweredeals viaarrivalalreadycounty tennesseeconfirm yourrating 50experience80 quotveryour parttosresortthemwithoutstaywellapplicablelatesttexas unitedinf countdestinationsnoour weeklyguestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelveryquotgoodquotexcitingstill haveresort mount charlestonmaywrongno resultsdates to getcabinrating 40nevada4ft condotopunited states 80charleston clarkweek 14dealspaymentrightcounty148night resortbearmount charlestoncounty colorado5strikedpricetitleapartmenttooltipsredirectbookvacasa websitemethodinstantvalidstates 90 quotoutstandingquotquotexcellentquotvacatia websitemethodinstanthaving to inquirepricepleaserating 38north carolina unitedout of 5strikedpricetitlecabintooltipsredirectbooklanguages englishyou for your0county californialikeft5strikedpricetitlecabintooltipsredirectbookduringallowshotrequestchargeshomeemail addressyou cancelangeles california unitedholidayflorida unitedup younight cabinback to youquotveryoffer directlycabintooltipsredirectbook this offercookiesvia emailwishguestsproviderget40 outaccommodationsfarmsstillprevious76 quotgoodquotaccommodationwithout havingofferhousetooltipsredirectbook this offerreservationempire businessstates 76washington united statessevier county tennessee5strikedpricetitleresorttooltipsredirectbook this offercallselectfewerrating 47showsper night houseactual arrivalclark20cannotdeparture datescan bookinquirepriceplease choose actualtripcancel your reservationunited states 94charlestoncharleston clark countydirectly without havingstates 76 quotgoodquotresultsstates 82mount charleston clarkreceive offersyouusedbookedcabinh2endtrailifgothong kongwimdu and ournevada unitedgoodstars4category3messagevalue82starmessageaverage rating 41exclusive dealsbedroomcheckpricefalsediscounttooltiph1resorth2endtrailinfquotoutstandingquotislandhavingfind yourprice22getreviews1 nightglobaltripper websitemethodinstant bookinginquirepricepleasevaluecarolinanight 7agree21county idaho unitedrating 41ourexclusive offersapply please readempireweeklybusinessyou canthese1 week 14morecondoh2endtrailout of 5strikedpricetitleresorttooltipsredirectbookunited states 82newsletter fullothercan15per nightmore accurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelverycruzft housemore accurate47 outsorryyou cancel yourrating 45 out18statesstarttrailmountper night resortnight resort mountcounty nevada united1 weekidahocountwebsitemethodinstant booking youreviewsstarmessageaverage rating2county nevadaangelesweekly emailsevierweek 2 guestsprovidergetchoose actual arrivalkongreviewsstarmessageaverage rating 40receivingnaplesstates 82 quotverylakevacationft cabinresort mounterror1 week 2freesoallows usexpedia websitemethodinstant bookingthereonlyowntouchfarms empire businesslistsstates 80popularftu00b2 condotooltipsredirectbookbelowsecurestatesfriget morewashingtonwantagain41 outcounty idahoexpediasantamynorth carolinashows offersrentalcancel yourfeetennesseecounty texasbeachesusbetweenbutinquirepriceplease choose45 outreviewstarmessageaverage ratingguests1026whichsigningfarms empiretravel dateslos angelesplease trybedroomcheckpricefalsediscounttooltiph1resorth2endtrail clarkreceiving our1 night 7rating 38 outherealaska united states117price persigning up youreduced pricedirectlyupget backoldcancellationtimeexpedia websitemethodinstantadditionalanyget a roomperfectcustomer serviceshowlivehousetooltipsredirectbookhave17condotooltipsredirectbookhtggaoptoutstates 90actual1infcondotooltipsredirectbook this offercondosettingsquotexcellentquot 1messagefloridaveryplacessatroom websitemethodinstantcounty washingtonplease readsanpartnerpricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelveryagree to our2 weeksget more accuratemay apply pleaseftu00b21 infdurationclark countynewunited statesstarttrailmounttennessee unitedvacasa websitemethodinstant bookingalsowebsitemethodinstanthave anymarketingapartmentcaliforniaonefire islandyourunited states 90departuredounited statestexasweekftu00b2 condoh2endtrailmost82 quotvery goodquotyou havewebsitemethodinstant bookingarrival and departurecitynightnextper night apartmentyour perfect1 reviewnotsanta cruzangeles californiauserhasoffer directly withouttrendshotelsyou likefoundtruesearch12reviewsstarmessageaverage rating 50sevier countyyour travelbackquestions5strikedpricetitlehousetooltipsredirectbook this offertryyour reservation2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelveryftu00b2 househ2endtrailreducedyou will receiverating 40 outhawaii unitedbook this offeryou agreemay applyour weekly emailcalifornia united statescustomerconfirmrating 50 outvacatia websitemethodinstant bookingoutwentstates 100 quotexcellentquotreviewreviewsstarmessageaverage rating 45booking youglobaltripper websitemethodinstantpartners2 weeks 21beenpartpolicyaccurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelverycounty tennessee unitedroom websitemethodinstant bookingcounty colorado unitedlatest trendsinformationnight apartmentcolorado unitedusemightapartmentsreviewsstarmessageaverageunitedfireapply pleaseour privacypolicylink24checkcostsclark county nevadacounty california united94 quotoutstandingquotlos angeles california5strikedpricetitleresorttooltipsredirectbookrating 47 outnot a validemail newsletteralaskadeals via emailstates 100tips38 outnewsletter16ftu00b2 cabinh2endtrailemail2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaveragegoodstars4category3messagevalue82starmessageaverage ratingconditionsgoodstars4category3messagevalue82starmessageaveragedetailscancelalaska unitedupcomingperoffersnight housegoodftu00b2 cabintooltipsredirectbooklosyorkyour vacationexclusivequotvery goodquotcabintooltipsredirectbook5strikedpricetitlecabintooltipsredirectbook this offerrating 41 outenglishgoodquot5strikedpricetitleapartmenttooltipsredirectbook this offerdateseenorthreviewstarmessageaveragenew york6states 80 quotveryaccuratesunplaceweek 2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelverynevada united statesstarttrailmount25out of 5strikedpricetitlehousetooltipsredirectbookallup you agreestates 94 quotoutstandingquothousemexicocity apartmenthelptermsmakecontactinf numberrating 45languagessigning upwebsitescreateyour favoriteaddressproperty13united states 765bedroomscheckpricefalsediscounttooltiph1cabinh2endtrailout of 5strikedpricetitleapartmenttooltipsredirectbook3parkgalvestonweek 2francecarolina united statesnevada united statessundaycoloradocheckindifferent

Longtail Keyword Density for Wimdu.com.pe

Keywords	Occurences
book this offer	48
dates to get	48
1 week 2	48
websitemethodinstant booking you	48
booking you can	48
you can book	48
offer directly without	48
directly without having	48
having to inquirepriceplease	48
inquirepriceplease choose actual	48
choose actual arrival	48
arrival and departure	48
get more accurate	48
expedia websitemethodinstant booking	33
per night cabin	11
5strikedpricetitlecabintooltipsredirectbook this offer	10
out of 5strikedpricetitlecabintooltipsredirectbook	10
county nevada united	8
county tennessee united	8
clark county nevada	8
per night house	8
housetooltipsredirectbook this offer	7
united states 100	7
rating 50 out	7
states 100 quotexcellentquot	7
5strikedpricetitlehousetooltipsredirectbook this offer	6
out of 5strikedpricetitlehousetooltipsredirectbook	6
5strikedpricetitleresorttooltipsredirectbook this offer	6
out of 5strikedpricetitleresorttooltipsredirectbook	6
rating 41 out	6
per night resort	6
82 quotvery goodquot	6
county washington united	6
united states 82	6
states 82 quotvery	6
sevier county tennessee	6
county california united	6
california united states	6
rating 45 out	5
reviewsstarmessageaverage rating 50	5
rating 40 out	5
florida united states	5
per night apartment	5
vacasa websitemethodinstant booking	5
reviewsstarmessageaverage rating 45	4
agree to our	4
county idaho united	4
tennessee united states	4
united states 76	4
north carolina united	4
up you agree	4
condotooltipsredirectbook this offer	4
county texas united	4
you will receive	4
county colorado united	4
nevada united states	4
united states 80	4
states 80 quotvery	4
goodstars4category3messagevalue82starmessageaverage rating 41	4
cabintooltipsredirectbook this offer	4
signing up you	4
80 quotvery goodquot	4
angeles california united	4
los angeles california	4
apply please read	3
globaltripper websitemethodinstant booking	3
5strikedpricetitleapartmenttooltipsredirectbook this offer	3
1 night 7	3
may apply please	3
our weekly email	3
1 week 14	3
2 weeks 21	3
not a valid	3
receiving our weekly	3
weekly email newsletter	3
email newsletter full	3
you for your	3
offers from wimdu	3
wimdu and our	3
there are no	3
deals via e-mail	3
back to you	3
you cancel your	3
cancel your reservation	3
out of 5strikedpricetitleapartmenttooltipsredirectbook	3
alaska united states	3
rating 38 out	3
night resort mount	3
states 76 quotgoodquot	3
farms empire business	3
carolina united states	3
bedroomcheckpricefalsediscounttooltiph1resorth2endtrail clark county	3
nevada united statesstarttrailmount	3
week 2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery	3
2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage	3
guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage rating	3
washington united states	3
vacatia websitemethodinstant booking	3
quotexcellentquot 1 review	3
states 94 quotoutstandingquot	3
reviewsstarmessageaverage rating 38	3
united states 94	3
states 90 quotoutstandingquot	3
united states 90	3
more accurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelvery	3
week 2 guestsproviderget	3
get a room	3
room websitemethodinstant booking	3
rating 47 out	3
charleston clark county	3
mount charleston clark	3
reviewsstarmessageaverage rating 40	3
resort mount charleston	3
read the terms	3
you can	55
1 week	53
united states	50
more accurate	50
per night	49
week 2	48
offer directly	48
actual arrival	48
without having	48
departure dates	48
directly without	48
get more	48
websitemethodinstant booking	48
can book	48
choose actual	48
booking you	48
inquirepriceplease choose	48
expedia websitemethodinstant	33
reviewsstarmessageaverage rating	28
quotvery goodquot	14
california united	12
night cabin	11
florida united	10
tennessee united	8
inf count	8
county tennessee	8
night house	8
nevada united	8
county nevada	8
clark county	8
your booking	8
vacation rentals	7
states 100	7
100 quotexcellentquot	7
ftu00b2 househ2endtrail	7
50 out	7
ftu00b2 housetooltipsredirectbook	7
rating 50	7
ft house	7
41 out	6
county california	6
night resort	6
states 82	6
82 quotvery	6
please try	6
sevier county	6
carolina united	6
rating 41	6
alaska united	6
washington united	6
county washington	6
los angeles	5
1 review	5
have any	5
vacasa websitemethodinstant	5
rating 40	5
you have	5
reviewstarmessageaverage rating	5
45 out	5
night apartment	5
rating 45	5
40 out	5
confirm your	4
ftu00b2 cabinh2endtrail	4
ftu00b2 condotooltipsredirectbook	4
ftu00b2 condoh2endtrail	4
signing up	4
up you	4
you agree	4
exclusive deals	4
ftu00b2 cabintooltipsredirectbook	4
travel dates	4
80 quotvery	4
ft condo	4
ft cabin	4
county texas	4
texas united	4
fire island	4
new york	4
states 80	4
goodstars4category3messagevalue82starmessageaverage rating	4
states 76	4
cancel your	4
county idaho	4
idaho united	4
county colorado	4
colorado united	4
hawaii united	4
find your	4
you like	4
inf number	4
north carolina	4
angeles california	4
you want	3
exclusive offers	3
receiving our	3
our weekly	3
please read	3
weekly email	3
our privacypolicylink	3
email newsletter	3
newsletter full	3
reduced price	3
latest trends	3
price per	3
apply please	3
may apply	3
your reservation	3
our parttos	3
receive offers	3
no results	3
1inf count	3
you cancel	3
get back	3
allows us	3
your perfect	3
via e-mail	3
deals via	3
your travel	3
1 inf	3
still have	3
city apartment	3
weeks 21	3
76 quotgoodquot	3
shows offers	3
customer service	3
your vacation	3
hong kong	3
santa cruz	3
empire business	3
farms empire	3
quotexcellentquot 1	3
bedroomcheckpricefalsediscounttooltiph1resorth2endtrail clark	3
94 quotoutstandingquot	3
states 94	3
90 quotoutstandingquot	3
states 90	3
charleston clark	3
mount charleston	3
resort mount	3
languages english	3
united statesstarttrailmount	3
2 weeks	3
38 out	3
week 14	3
night 7	3
1 night	3
has been	3
your favorite	3
can find	3
globaltripper websitemethodinstant	3
rating 38	3
2 guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery	3
47 out	3
rating 47	3
room websitemethodinstant	3
2 guestsproviderget	3
accurate pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelvery	3
vacatia websitemethodinstant	3
guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery goodstars4category3messagevalue82starmessageaverage	3
email address	3
0	131
you	115
offer	101
united	100
your	78
more	65
can	64
booking	62
get	59
dates	58
county	58
1	55
week	53
per	53
accurate	52
night	52
book	50
choose	50
without	50
states	50
having	49
inquirepriceplease	48
departure	48
arrival	48
websitemethodinstant	48
actual	48
directly	48
rating	41
out	41
expedia	33
guests	32
our	32
ftu00b2	32
reviews	31
count	28
reviewsstarmessageaverage	28
wimdu	23
have	21
offers	19
travel	17
inf	16
all	16
ft	16
city	16
available	16
new	16
us	15
vacation	15
cabin	15
house	15
please	15
we	15
price	14
email	14
quotvery	14
goodquot	14
no	13
florida	13
california	12
property	11
up	11
find	11
quotexcellentquot	11
deals	10
5strikedpricetitlecabintooltipsredirectbook	10
receive	10
rentals	10
not	10
exclusive	9
quotoutstandingquot	9
review	9
weeks	9
2	9
any	8
service	8
but	8
accommodation	8
terms	8
apartment	8
see	8
clark	8
cookies	8
use	8
nevada	8
tennessee	8
3	7
do	7
resort	7
read	7
4	7
5	7
if	7
via	7
6	7
househ2endtrail	7
information	7
housetooltipsredirectbook	7
7	6
number	6
perfect	6
8	6
5strikedpricetitleresorttooltipsredirectbook	6
stay	6
experience	6
like	6
var	6
5strikedpricetitlehousetooltipsredirectbook	6
one	6
rental	6
alaska	6
results	6
9	6
wish	6
carolina	6
quotgoodquot	6
already	6
mount	6
try	6
1inf	6
sevier	6
partner	6
washington	6
stories	6
10	5
here	5
upcoming	5
found	5
create	5
during	5
11	5
reviewstarmessageaverage	5
date	5
select	5
cancellation	5
pm	5
york	5
island	5
fire	5
providers	5
customer	5
los	5
angeles	5
might	5
has	5
marketing	5
vacasa	5
search	5
best	5
full	5
also	5
different	5
free	5
charleston	5
bedroomscheckpricefalsediscounttooltiph1cabinh2endtrail	5
help	5
hawaii	5
12	5
make	5
latest	4
want	4
sent	4
cannot	4
13	4
room	4
good	4
costs	4
partners	4
applicable	4
contact	4
signing	4
agree	4
them	4
condoh2endtrail	4
cabintooltipsredirectbook	4
cabinh2endtrail	4
hotels	4
show	4
condotooltipsredirectbook	4
fewer	4
duration	4
confirm	4
place	4
colorado	4
14	4
allows	4
reduced	4
apartments	4
cancel	4
texas	4
15	4
may	4
own	4
most	4
16	4
conditions	4
mexico	4
payment	4
goodstars4category3messagevalue82starmessageaverage	4
south	4
questions	4
only	4
17	4
e-mail	4
booked	4
user	4
north	4
previous	4
condo	4
idaho	4
saved	4
address	4
old	4
next	4
true	4
privacy	4
santa	4
these	4
got	4
san	4
18	4
trip	3
provider	3
accommodations	3
websites	3
below	3
there	3
partpolicy	3
parttos	3
used	3
call	3
places	3
still	3
19	3
touch	3
error	3
between	3
went	3
wrong	3
data	3
my	3
sorry	3
back	3
happy	3
reservation	3
fee	3
value	3
apply	3
charges	3
settings	3
privacypolicylink	3
users	3
availability	3
so	3
guestsprovidervacatiaprovideridvacatiaratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue41labelvery	3
check	3
over	3
live	3
worlds	3
exciting	3
hong	3
kong	3
beaches	3
home	3
holiday	3
very	3
secure	3
right	3
time	3
well	3
range	3
france	3
popular	3
htggaoptout	3
top	3
20	3
21	3
bear	3
lake	3
22	3
galveston	3
23	3
destinations	3
park	3
farms	3
empire	3
business	3
cruz	3
hot	3
naples	3
function	3
sunday	3
trends	3
24	3
favorite	3
details	3
inquiry	3
message	3
been	3
other	3
valid	3
again	3
check-in	3
string	3
tips	3
receiving	3
weekly	3
newsletter	3
lists	3
request	3
fri	3
bedroomcheckpricefalsediscounttooltiph1resorth2endtrail	3
sat	3
sun	3
shows	3
which	3
languages	3
english	3
statesstarttrailmount	3
were	3
vacatia	3
pricestyperesortlinkconstraintsbadgeindicatorlocationlogoslugsalesargumentsslot10001typeratingpropsrating41labelvery	3
guestsproviderget	3
25	3
26	3
5strikedpricetitleapartmenttooltipsredirectbook	3
globaltripper	3
additional	3

Who hosts Wimdu.com.pe?

Wimdu.com.pe Hosting Provider Information

Hosted IP Address:	212.114.33.35
Hosted Hostname:	ger13-2.wwwserver.net
Service Provider:	TelemaxX Telekommunikation GmbH
Hosted Country:	DE
Location Latitude:	51.2993
Location Longitude:	9.491
Webserver Software:	nginx

Is "TelemaxX Telekommunikation GmbH" in the Top 10 Hosting Companies?

Name

Percentage

DoD Network Information Center

16.7387%

GoDaddy.com, LLC

8.5968%

Namecheap, Inc.

4.2653%

Confluence Networks Inc

2.7791%

Google Inc.

2.3954%

Merit Network Inc.

1.8799%

Fara Negar Pardaz Khuzestan

1.8361%

1&1 Internet AG

1.8274%

Amazon.com, Inc.

1.7814%

Cogent Communications

1.6096%

TelemaxX Telekommunikation GmbH

0.0075%

HTTP Header Analysis for Wimdu.com.pe

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Connection:	keep-alive
Server:	nginx
Content-Type:	text/html; charset=UTF-8
Cache-Control:	private, must-revalidate
Strict-Transport-Security:	max-age=31536000; includeSubDomains
pragma:	no-cache
expires:	-1
X-Frame-Options:	sameorigin
Content-Encoding:	gzip
Accept-Ranges:	bytes
Date:	Tue, 08 Dec 2020 14:41:01 GMT
Via:	1.1 varnish
X-Served-By:	cache-lon4235-LON
X-Cache:	MISS
X-Cache-Hits:	0
X-Timer:	S1607438461.477041,VS0,VE174
Vary:	Accept-Encoding, Accept-Encoding
transfer-encoding:	chunked

Wimdu.com.pe Domain Nameserver Information

Host	IP Address	Country
ns1.is-fun.net	212.114.35.78
ns2.is-fun.net	192.174.68.100

Need to find out who hosts Wimdu.com.pe?

Domain Registration (WhoIs) information for Wimdu.com.pe

 Domain Name: wimdu.com.pe
WHOIS Server: NIC .PE
Sponsoring Registrar: InterNetX GmbH
Domain Status: ok
Registrant Name: Stevan Lutz
Admin Name: Stevan Lutz
Admin Email: Login to show email
 Server: ns1.is-fun.net
Name Server: ns2.is-fun.net
DNSSEC: unsigned
>>> Last update of WHOIS database: 2020-12-08T14:37:43.282Z