Appartementen, vakantiehuizen en bed and breakfasts - Wimdu

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 737,278
Estimated Worth: $1,680

Wimdu heeft wereldwijd een ruim aanbod aan vakantie appartementen en vakantiehuizen ✔ Vanaf €10 per nacht verblijf je in een appartement ✔ Boek nu!



Domain summary

Last updated
2020-10-20
Domain label
wimdu
Domain extension
nl
Global Traffic Rank
737,278
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is wimdu.nl ranked relative to other sites:

Percentage of visits to wimdu.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wimdu.nl registered?
A: Wimdu.nl was registered 5 months, 4 weeks, 2 hours, 38 minutes, 30 seconds ago on Tuesday, October 20, 2020.
Q: When was the WHOIS for Wimdu.nl last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 2 hours, 38 minutes, 30 seconds ago on Tuesday, October 20, 2020.
Q: What are Wimdu.nl's nameservers?
A: DNS for Wimdu.nl is provided by the following nameservers:
  • ns-229.awsdns-28.com
  • ns-938.awsdns-53.net
  • ns-1459.awsdns-54.org
  • ns-1563.awsdns-03.co.uk
Q: Who is the registrar for the Wimdu.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Wimdu.nl?
A: Wimdu.nl ranks 737,278 globally on Alexa. Wimdu.nl has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Wimdu.nl each day?
A: Wimdu.nl receives approximately 1,133 visitors and 2,266 page impressions per day.
Q: What IP address does Wimdu.nl resolve to?
A: Wimdu.nl resolves to the IPv4 address 151.101.1.64.
Q: In what country are Wimdu.nl servers located in?
A: Wimdu.nl has servers located in the United States.
Q: What webserver software does Wimdu.nl use?
A: Wimdu.nl is powered by Varnish webserver.
Q: Who hosts Wimdu.nl?
A: Wimdu.nl is hosted by Consortium GARR in United States.
Q: How much is Wimdu.nl worth?
A: Wimdu.nl has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Wimdu.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wimdu.nl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wimdu.nl

H1 Headings

1 :
  1. Op zoek naar je perfecte vakantieaccommodatie? Gebruik Wimdu!

H2 Headings

3 :
  1. ONZE TOPBESTEMMINGEN
  2. Vind Je Perfecte Vakantiewoning
  3. Onze mooiste bestemmingen

H3 Headings

47 :
  1. Appartement
  2. Huis
  3. Huis
  4. Huis
  5. Huis
  6. Huis
  7. Huis
  8. Huis
  9. Huis
  10. Huis
  11. Huis
  12. Huis
  13. Huis
  14. Huis
  15. Huis
  16. Huis
  17. Huis
  18. Huis 90 m²
  19. Huis
  20. Appartement 34 m²
  21. Chalet 45 m²
  22. Appartement 39 m²
  23. Huis
  24. Appartement 39 m²
  25. Appartement 60 m²
  26. Appartement 30 m²
  27. Appartement 60 m²
  28. Chalet 45 m²
  29. Villa 194 m²
  30. Appartement 29 m²
  31. Appartement 16 m²
  32. Villa 150 m²
  33. Huis 95 m²
  34. Chalet 50 m²
  35. Appartement 72 m²
  36. Huis 105 m²
  37. Huis
  38. POPULAIRE STEDEN
  39. POPULAIRE VAKANTIEBESTEMMINGEN
  40. POPULAIRE LANDEN
  41. Ontdek Londen
  42. Amsterdam
  43. COSTA BRAVA
  44. Rio de Janeiro
  45. Kopenhagen
  46. KROATIË
  47. Alle landen

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

46 :

Google Adsense

:
pub-2065291527898394

Google Analytics

:
UA-45666214-1

Links - Internal

142:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wimdu.nl

vindt uu00e9u00e9n klik1kostennog geentuivillasmethodgeen aanvraag nodigweek 2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddeldeextragegevens49 vanextra kostenlagerequotuitstekendquotvakantiewoningenvan 5strikedpricetitlehuistooltipsredirectboek deze2 beoordelingenper nacht appartementoverperiodemaarprijsbeoordeling 445partnertot hetannuleert kunnen1 week 2via hometogomethodboek dezediensten2aanbieding directvoor deze accommodatieklik kunt unotonze parttosgastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling 50maar wegastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde beoordeling 4414voor dezeom een2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddeldevoorwaarden vannewdirect boekenpricekiesm de cocksdorpakkoord met1inf countcountperhelaas5strikedpricetitlehuistooltipsredirectboek deze aanbiedingvan uwhoornhometogomethodboekparttosaanbieding via vrbomethodgeenzo23koogcancellationfreefalsesavepercentpricebedrooms1bedroomslabelcheckpricefalsediscounttooltiph1appartementtotgeboektte registreren gaatnederland 100beoordeling 44 vanexclusieve aanbiedingenbeoordeling 49 vanvinden opalaccommodatieverzendenzijn erwilt2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde beoordelingaanbieders1 nachtons9akkoord met onzeheefthtggaoptoutbeoordelingenstarmessagegemiddeldedirect op2 gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordelingzoalsinstellingen2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde beoordelingvan jegastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordelingeigenupdatesvrbomethodgeen aanvraagom de juisteinboxonze websiteplaatseu kunt dezedeze aanbieding directgastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde beoordelingappartement98 quotuitstekendquotnodig ucontact met u87 quotgoedquotvan 5strikedpricetitlechaletchaletweken 21via vrbomethodgeenter plaatsebelgivia vrbomethodgeen aanvraaghetwereldszalaanbiedingnuvakantiehuistexel nederlandvia tuivillasmethodgeenupdates over1 inf numberwe hebbeninformatiedeze accommodatie directnodig u kuntinf countvan eenallenederland 98 quotuitstekendquotweek 2registreren gaat ugoedquotpartpolicygastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordelingnemeneen vanvoor uwdestinationaankomstdatamet boekenpricekies1 week 14eru eentexel nederland 100uaanbiedingen ontvangenbestemmingen28svind jequotgoedquotden49 van 5strikedpricetitleappartementnacht huisexacte vertrekwe zijnzondagstadgaat ustrandmet boekenpricekies exacteprobeer hetu zultgeenhebbenbeoordeling 40 vannietu beginnenreisperiodebeoordeling 46quotzeer goedquotgaat40 van 5strikedpricetitlehuistooltipsredirectboekervaringslaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texelbencocksdorp texelverzoek29mijncocksdorpcancellationfreefalsesavepercentpricebedrooms1bedroomslabelcheckpricefalsediscounttooltiph1appartementmet hetnieuwe1 nacht 7cocksdorpcancellationfreefalsesavepercentpricebedrooms4bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texelhiermet onze parttosuw zoekopdrachtuwnogreisdatagoednacht chalet5strikedpricetitlehuistooltipsredirectboek dezenederland 98deze aanbiedingtexel nederlandstarttraildenederland 87 quotgoedquotjuiste3gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddeldevindt32contact metboekinggaat u akkoordvaluepartnersop onze5strikedpricetitlechaletvrbomethodgeeneenmdezebijinf numberslaapkamerscheckpricefalsediscounttooltiph1huishebben nogvanbeoordelingenbeoordelingvan 5strikedpricetitlehuisweek 2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddeldeonzeomdieprobeervragenvia wimdumu00b2tooltipsredirectboektruegebruikcocksdorpcancellationfreefalsesavepercentpricebedrooms3bedroomslabelaanbiedingen ontvangen vanwanneeraanbieding via hometogomethodboekhebmu00b2h2endtrailnederlandstarttrailde4koogcancellationfreefalsesavepercentpricebedrooms2bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrailgastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddeldeaccommodatie direct op46 van 5strikedpricetitlehuistooltipsredirectboekregistrerentexelbeginnen metalgemene voorwaardenweek 2 gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddeldeaanbieding via tuivillasmethodgeenmethuis de cocksdorp0worden5strikedpricetitlehuistooltipsredirectboekjuiste prijzen tehometogomethodboek deze accommodatiemu00b2tooltipsredirectboek deze aanbiedingweken6griekenlandweek 2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddeldealleen aanbiedingenaanvraag nodig17mu00b2h2endtrail texel nederlandstarttraildeproperty3050 van 5strikedpricetitlehuistooltipsredirectboekvertreku uw reserveringperfectegebruik van131 infaccommodatiesvan wimduuw boeking24nacht appartement20dan12exclusievem de koogvia tuivillasmethodgeen aanvraagverblijfdat uom umu00b2tooltipsredirectboek dezete registrerenlagere prijsu uw boekingvertrek en aankomstdataaanbiederopnieuwquotzeertuivillasmethodgeen aanvraaghuis de kooggebruikenbestvoorwaardenmakenkoog texelcocksdorpcancellationfreefalsesavepercentpricebedrooms4bedroomslabelhier uwkoogcancellationfreefalsesavepercentpricebedrooms2bedroomslabelbeoordelingstarmessagegemiddeldecocksdorpreserveringtealgemeneregistreren gaatibizamet u50 vanu00e9u00e9n klik kuntontvangen van wimdunederland 80 quotgoedquotstringu akkoordannuleertnumberhotelscookiesbeginnen met boekenpricekiesuw reservering annuleertdoordatvakantiewoning2 wekenveelvindhometogomethodboek dezesuccesvolslaapkamerscheckpricefalsediscounttooltiph1huish2endtrailwatvolgendegekozenmoment22villa26je21accommodatie directcontact2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde40 vankunt umeer danopmeestweekom jeprijzen tekunnenvarnederlandvrbomethodgeen aanvraag nodigbeschikbares werelds1 beoordelingnacht 734boekenpricekies exactezult aanbiedingendeze accommodatieyou1inf80 quotgoedquotmet u00e9u00e9n klikhuisdirect2 weken 21akkoordkunnen wenederland 805strikedpricetitlehuisgastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling 50zorgvuldigternodigkunt dezeu00e9u00e9nnaarmet onze46 van10contact opnederland 100 quotuitstekendquotgraagbeginnenmet u00e9u00e9nfiltersontvangtcocksdorp texel nederlanduw emailadreszoekresultatenzijnzoekopdracht44 vanonze partnersbeoordeling 46 vankoog texel nederlandtipseen emailtexel nederland 875strikedpricetitleappartementwimdudirect op onzetexel nederland 80klik kuntgastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde beoordelingtalenaanvraaggastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde beoordeling 49koog271 weeklatenmomenteelboeken2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddeldeuitvindenboekenpricekiesmeer33datau zult aanbiedingennederland 87beoordeling 50 vanontvangen vanu akkoord metkuntvan 5strikedpricetitleappartementcocksdorpcancellationfreefalsesavepercentpricebedrooms4bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrailmogelijkwebsite metzultstoriesbeoordeling 40websitereservering annuleertkliku beginnen metom tegastentexel nederland 98beoordelingstarmessagegemiddelde beoordelingbeoordeling 49vakantiehuizenwijprijzenwordtberichtweexacte2 gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddeldeuw reserveringreisemailadreslees7website met u00e9u00e9ngratisop onze websiteaankomendreservering annuleert kunnenu kuntbeschikbaarben jeaanvraag nodig ugevondennachtvakantieaccommodatievooreen beoordelingzult aanbiedingen ontvangengastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddeldevan 5strikedpricetitlehuistooltipsredirectboekhierdoorkoogcancellationfreefalsesavepercentpricebedrooms2bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texelbeoordeling 50slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texel nederlandstarttraildeweek 14beoordelingenstarmessagegemiddelde beoordelingzijn geenmu00b2h2endtrail texel25gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddeldeboekenpricekies exacte vertrekonze website metdirect boekenpricekies exactevorigaankomstdata om162 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordelingkaninfper nacht huislevenaanbieding direct boekenpricekiesaanbiedingenalleenpopulairekoogcancellationfreefalsesavepercentpricebedrooms3bedroomslabelper nacht chaletaanbiedingen met15gastper nachtaan hetjuiste prijzenkunt deze aanbiedingontvangenemail31alsaan188snel11your100 quotuitstekendquotviavia hometogomethodboeku uwfunctionwimdu en onzekunt u beginnenwebsitesdeze aanbieding viaalstublieftinformatie overaanbieding viahebttuivillasmethodgeenreizigers19ook

Longtail Keyword Density for Wimdu.nl

KeywordsOccurences
deze aanbieding via37
1 week 237
juiste prijzen te37
om de juiste37
vertrek- en aankomstdata37
boekenpricekies exacte vertrek-37
deze aanbieding direct24
aanvraag nodig u24
nodig u kunt24
u kunt deze24
kunt deze aanbieding24
direct boekenpricekies exacte24
aanbieding direct boekenpricekies24
per nacht huis22
koog texel nederland21
aanbieding via tuivillasmethodgeen19
tuivillasmethodgeen aanvraag nodig19
via tuivillasmethodgeen aanvraag19
slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texel nederlandstarttrailde18
van 5strikedpricetitlehuistooltipsredirectboek deze18
5strikedpricetitlehuistooltipsredirectboek deze aanbieding18
mu00b2tooltipsredirectboek deze aanbieding17
mu00b2h2endtrail texel nederlandstarttrailde16
texel nederland 10015
nederland 100 quotuitstekendquot15
beoordeling 50 van15
cocksdorp texel nederland14
deze accommodatie direct13
accommodatie direct op13
aanbieding via hometogomethodboek13
direct op onze13
via hometogomethodboek deze13
hometogomethodboek deze accommodatie13
met boekenpricekies exacte13
onze website met13
website met u00e9u00e9n13
beginnen met boekenpricekies13
op onze website13
kunt u beginnen13
m de koog13
klik kunt u13
u00e9u00e9n klik kunt13
met u00e9u00e9n klik13
u beginnen met13
huis de cocksdorp11
per nacht appartement10
50 van 5strikedpricetitlehuistooltipsredirectboek8
week 2 gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde8
2 gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling8
gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling 508
huis de koog7
contact met u6
40 van 5strikedpricetitlehuistooltipsredirectboek5
beoordeling 40 van5
texel nederland 985
nederland 98 quotuitstekendquot5
texel nederland 805
nederland 80 quotgoedquot5
week 2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde5
2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde beoordeling5
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde beoordeling 495
beoordeling 49 van5
49 van 5strikedpricetitleappartement5
week 2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde4
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling 504
akkoord met onze4
u akkoord met4
2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling4
1 inf number4
koogcancellationfreefalsesavepercentpricebedrooms2bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texel4
beoordeling 46 van4
cocksdorpcancellationfreefalsesavepercentpricebedrooms4bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texel4
gaat u akkoord4
uw reservering annuleert3
u uw reservering3
u uw boeking3
registreren gaat u3
u zult aanbiedingen3
zult aanbiedingen ontvangen3
aanbiedingen ontvangen van3
ontvangen van wimdu3
wimdu en onze3
voor deze accommodatie3
met onze parttos3
via vrbomethodgeen aanvraag3
te registreren gaat3
2 weken 213
1 week 143
1 nacht 73
beoordeling 44 van3
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde beoordeling 443
2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde beoordeling3
week 2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde3
vrbomethodgeen aanvraag nodig3
aanbieding via vrbomethodgeen3
46 van 5strikedpricetitlehuistooltipsredirectboek3
per nacht chalet3
nederland 87 quotgoedquot3
texel nederland 873
m de cocksdorp3
reservering annuleert kunnen3
deze aanbieding63
1 week43
per nacht39
juiste prijzen37
aankomstdata om37
exacte vertrek-37
boekenpricekies exacte37
week 237
texel nederland37
aanbieding via37
prijzen te37
texel nederlandstarttrailde35
u kunt25
aanbieding direct24
direct boekenpricekies24
kunt deze24
aanvraag nodig24
nodig u24
nacht huis22
koog texel21
tuivillasmethodgeen aanvraag19
via tuivillasmethodgeen19
kunt u18
slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail texel18
5strikedpricetitlehuistooltipsredirectboek deze18
van 5strikedpricetitlehuistooltipsredirectboek18
mu00b2h2endtrail texel17
mu00b2tooltipsredirectboek deze17
deze accommodatie16
beoordeling 5015
nederland 10015
100 quotuitstekendquot15
50 van15
op onze15
onze website14
cocksdorp texel14
hometogomethodboek deze13
via hometogomethodboek13
met boekenpricekies13
website met13
beginnen met13
u beginnen13
klik kunt13
u00e9u00e9n klik13
met u00e9u00e9n13
accommodatie direct13
direct op13
nacht appartement10
u uw9
voor uw9
inf count9
uw boeking9
gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling8
van uw8
contact met8
exclusieve aanbiedingen8
van 5strikedpricetitleappartement8
2 gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde8
beoordelingenstarmessagegemiddelde beoordeling8
quotzeer goedquot7
we hebben7
met u6
1 inf6
van wimdu6
40 van5
1 nacht5
nederland 805
nederland 985
98 quotuitstekendquot5
een van5
akkoord met5
hier uw5
2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde5
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde beoordeling5
beoordeling 495
49 van5
met onze5
beoordeling 405
80 quotgoedquot5
dat u5
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde beoordeling4
2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde4
voor deze4
gaat u4
u akkoord4
aanbiedingen ontvangen4
inf number4
1 beoordeling4
46 van4
koogcancellationfreefalsesavepercentpricebedrooms2bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail4
kunnen we4
cocksdorpcancellationfreefalsesavepercentpricebedrooms4bedroomslabel slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail4
algemene voorwaarden4
van een4
informatie over4
vindt u4
beoordeling 464
vind je4
om een4
om te4
om u3
met het3
onze partners3
nog geen3
lagere prijs3
contact op3
uw e-mailadres3
zijn er3
ter plaatse3
zijn geen3
tot het3
extra kosten3
gebruik van3
u een3
annuleert kunnen3
reservering annuleert3
uw reservering3
we zijn3
een beoordeling3
vinden op3
hebben nog3
maar we3
1inf count3
een e-mail3
ontvangen van3
van 5strikedpricetitlehuis3
beoordeling 443
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde beoordeling3
2 gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde3
vrbomethodgeen aanvraag3
via vrbomethodgeen3
om je3
beoordelingstarmessagegemiddelde beoordeling3
ben je3
aan het3
meer dan3
via wimdu3
van je3
alleen aanbiedingen3
aanbiedingen met3
44 van3
s werelds3
zult aanbiedingen3
2 weken3
u zult3
onze parttos3
registreren gaat3
te registreren3
updates over3
weken 213
week 143
nacht chalet3
nacht 73
uw zoekopdracht3
probeer het3
van 5strikedpricetitlechalet3
2 beoordelingen3
nederland 873
87 quotgoedquot3
voorwaarden van3
0110
u103
van96
deze95
te79
texel76
uw72
om69
met67
aanbieding63
voor62
op50
via49
een46
kunt46
145
per44
nacht44
week43
beoordeling43
nederland40
direct39
prijzen39
het38
exacte38
onze38
aankomstdata37
juiste37
je37
boekenpricekies37
vertrek-37
nederlandstarttrailde35
count30
aanbiedingen28
gasten27
accommodatie26
aanvraag26
zijn25
wimdu24
nodig24
huis22
we22
koog21
geen20
220
quotuitstekendquot20
tuivillasmethodgeen19
meer18
5strikedpricetitlehuistooltipsredirectboek18
slaapkamerscheckpricefalsediscounttooltiph1huish2endtrail18
ons17
mu00b2h2endtrail17
mu00b2tooltipsredirectboek17
m17
tot16
inf16
website16
315
cocksdorp14
u00e9u00e9n14
hometogomethodboek13
over13
klik13
er13
beginnen13
kunnen13
die12
bij12
prijs11
beoordelingen11
contact11
hier11
niet11
dan11
hebben11
dat11
aan11
411
heeft10
boeking10
beschikbaar10
worden10
alle10
appartement10
nog9
naar9
weken9
59
5strikedpricetitleappartement8
cookies8
gastenprovidertuivillasprovideridtuivillasratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde8
hebt8
accommodaties8
quotgoedquot8
exclusieve8
beoordelingenstarmessagegemiddelde8
e-mail8
vinden7
1inf7
nu7
zal7
goedquot7
al7
e-mailadres7
quotzeer7
67
77
data7
maar7
86
96
alleen6
106
116
wilt6
beschikbare6
door6
voorwaarden6
var6
126
informatie6
vragen6
wat6
koogcancellationfreefalsesavepercentpricebedrooms1bedroomslabelcheckpricefalsediscounttooltiph1appartement6
als6
ervaring6
vakantiewoning6
partners6
verblijf5
aanbieders5
wordt5
kosten5
hotels5
filters5
laten5
partner5
koogcancellationfreefalsesavepercentpricebedrooms2bedroomslabel5
ontvangen5
number5
mijn5
wij5
akkoord5
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue49labeluitstekendstars5category5messagevalue98starmessagegemiddelde5
opnieuw5
goed5
perfecte5
135
gebruik5
meest5
den5
145
ook5
new5
volgende5
nieuwe5
155
zo5
165
probeer4
nemen4
174
184
stad4
ontvangt4
populaire4
werelds4
194
graag4
uit4
204
aanbieder4
websites4
tips4
gaat4
vind4
cocksdorpcancellationfreefalsesavepercentpricebedrooms4bedroomslabel4
vakantiewoningen4
stories4
your4
reizigers4
true4
algemene4
bestemmingen4
snel4
vakantiehuis4
gratis4
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue50labeluitstekendstars5category5messagevalue100starmessagegemiddelde4
vindt4
214
you4
gegevens3
zorgvuldig3
plaatse3
ter3
instellingen3
extra3
223
chalet3
gast3
value3
aankomend3
zoekresultaten3
verzenden3
vorig3
destination3
gebruiken3
best3
lagere3
annuleert3
reservering3
mogelijk3
wanneer3
geboekt3
reis3
succesvol3
veel3
not3
diensten3
hierdoor3
maken3
zoals3
moment3
eigen3
alstublieft3
periode3
gevonden3
kan3
boeken3
htggaoptout3
s3
bericht3
vakantieaccommodatie3
ben3
zoekopdracht3
leven3
heb3
verzoek3
vakantiehuizen3
5strikedpricetitlechalet3
function3
233
243
253
gastenproviderhometogoprovideridexpediaepsratingsmaxstarvalue50reviewcountnullreviewswithtextcount0starvalue44labelgoedstars45category3messagevalue87starmessagegemiddelde3
cocksdorpcancellationfreefalsesavepercentpricebedrooms1bedroomslabelcheckpricefalsediscounttooltiph1appartement3
vrbomethodgeen3
5strikedpricetitlehuis3
zondag3
slaapkamerscheckpricefalsediscounttooltiph1huis3
beoordelingstarmessagegemiddelde3
koogcancellationfreefalsesavepercentpricebedrooms3bedroomslabel3
cocksdorpcancellationfreefalsesavepercentpricebedrooms3bedroomslabel3
263
belgi3
griekenland3
lees3
inbox3
hoorn3
villa3
273
283
293
303
zult3
partpolicy3
parttos3
talen3
registreren3
313
323
333
updates3
momenteel3
reisdata3
string3
reisperiode3
gekozen3
helaas3
ibiza3
strand3
343
property3

Who hosts Wimdu.nl?

Wimdu.nl Hosting Provider Information

Hosted IP Address:151.101.1.64
Hosted Hostname:151.101.1.64
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Varnish

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Consortium GARR
0.1218%

HTTP Header Analysis for Wimdu.nl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: Varnish
Retry-After: 0
Location: https://wimdu.nl/
Content-Length: 0
Accept-Ranges: bytes
Date: Tue, 20 Oct 2020 16:05:40 GMT
Via: 1.1 varnish
Connection: close
X-Served-By: cache-lcy19247-LCY
X-Cache: HIT
X-Cache-Hits: 0
X-Timer: S1603209940.258077,VS0,VE0

Wimdu.nl Domain Nameserver Information

HostIP AddressCountry
ns-229.awsdns-28.com 205.251.192.229
ns-938.awsdns-53.net 205.251.195.170
ns-1459.awsdns-54.org 205.251.197.179
ns-1563.awsdns-03.co.uk 205.251.198.27


Need to find out who hosts Wimdu.nl?


Domain Registration (WhoIs) information for Wimdu.nl

 Domain name: wimdu.nl
Status: active

Registrar:
IS-Fun Internet Services GmbH
Badhausweg 8
76307 Karlsbad
Germany

Abuse Contact:

Creation Date: 2011-03-21

Updated Date: 2019-01-17

DNSSEC: no

Domain nameservers:
ns-229.awsdns-28.com
ns-938.awsdns-53.net
ns-1459.awsdns-54.org
ns-1563.awsdns-03.co.uk

Record maintained by: NL Domain Registry

As the registrant's address is not in the Netherlands, the registrant is
obliged by the General Terms and Conditions for .nl Registrants to use
SIDN's registered office address as a domicile address. More information
on the use of a domicile address may be found at
https://www.sidn.nl/downloads/procedures/Domicile_address.pdf

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Recently Updated Websites

Molihomes.com (1 second ago.)Boudreaux.website (1 second ago.)Iot-hub.social (2 seconds ago.)Ecobonus-110.space (2 seconds ago.)X1-shop.de (2 seconds ago.)Baracusmedya.com (3 seconds ago.)Iwebvisit.com (3 seconds ago.)Itsonlymind.com (3 seconds ago.)Modlezakolace.com (3 seconds ago.)Avibox.link (3 seconds ago.)Psmonger.com (4 seconds ago.)Chinatlyq.com (4 seconds ago.)Biopathlabs.com (4 seconds ago.)Feetmattersmedinailspa.com (4 seconds ago.)Zenithmun.com (4 seconds ago.)Brilliantidea.xyz (4 seconds ago.)Evapaez.es (4 seconds ago.)Kuzn-church.com (4 seconds ago.)Sushi-online.ru (5 seconds ago.)Christinajung-voice.com (5 seconds ago.)Jj-vlog.net (5 seconds ago.)Fanavaran-ag.ir (5 seconds ago.)Mrcrabcakes.com (5 seconds ago.)Genosi.gr (5 seconds ago.)Bringthehamstersback.com (6 seconds ago.)Thephilanthropycollective.com (6 seconds ago.)Need.beer (6 seconds ago.)Signonasl.com (6 seconds ago.)Divert-partnership.com (7 seconds ago.)Vitorenayara.com (7 seconds ago.)

Recently Searched Keywords

2020 ndash (9 seconds ago.)clinical trials in children (13 seconds ago.)apothecary (15 seconds ago.)2019 world series: astros vs nationals (17 seconds ago.)total votes containerfindformonesubmit (19 seconds ago.)reel thrill (19 seconds ago.)bvi (20 seconds ago.)minden (21 seconds ago.)fat gay (22 seconds ago.)duolingo arabic (34 seconds ago.)obra maestra (36 seconds ago.)bankruptcy attorney orange county (41 seconds ago.)mehmet gören (44 seconds ago.)pricena dubai (50 seconds ago.)applicationjsonodataverbose headers accept (57 seconds ago.)babys erstes jahr (1 minute 3 seconds ago.)nu nghin (1 minute 5 seconds ago.)الشاي (1 minute 13 seconds ago.)canl bahis oynamak (1 minute 24 seconds ago.)piquadro (1 minute 24 seconds ago.)initialvotes 0 pollanswersforeachfunctionanswer (1 minute 28 seconds ago.)müxtəlif (1 minute 29 seconds ago.)satkahon (1 minute 38 seconds ago.)aid mb (1 minute 43 seconds ago.)rolanddg (1 minute 43 seconds ago.)adj pitching (1 minute 45 seconds ago.)rhône blends (1 minute 46 seconds ago.)doppelstegplatten (1 minute 53 seconds ago.)parviz tanavoli (1 minute 55 seconds ago.)lowe 2nd (1 minute 57 seconds ago.)