Windelschreck.org  |  Amazon.de: Günstige Preise für Elektronik & Foto, Filme, Musik, Bücher, Games, Spielzeug & mehr
Low trust score  | 
Entdecken, shoppen und einkaufen bei Amazon.de: Günstige Preise für Elektronik & Foto, Filme, Musik, Bücher, Games, Spielzeug, Sportartikel, Drogerie & mehr bei Amazon.de




Windelschreck.org Website Information

Website Ranks & Scores for Windelschreck.org

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Windelschreck.org

Domain Registrar: Public Interest Registry
Registration Date:2016-04-07  3 years 2 months 4 days ago
Last Modified:2018-10-19  7 months 3 weeks 3 days ago
Expiration Date:2018-10-19  7 months 3 weeks 3 days ago

Whois information for windelschreck.org

Full Whois Lookup for Windelschreck.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Windelschreck.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: WINDELSCHRECK.ORG
Registry Domain ID: D189296446-LROR
Registrar WHOIS Server: whois.meshdigital.com
Registrar URL: http://www.domainmonster.com
Updated Date: 2018-09-28T16:30:15Z
Creation Date: 2016-07-04T15:23:20Z
Registry Expiry Date: 2019-07-04T15:23:20Z
Registrar Registration Expiration Date:
Registrar: Mesh Digital Limited
Registrar IANA ID: 1390
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +44.1483304030
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: DE
Name Server: NS2.NAMESPACE4YOU.COM
Name Server: NS.NAMESPACE4YOU.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2018-10-19T17:15:48Z

Who hosts Windelschreck.org?

Windelschreck.org is hosted by domainfactory GmbH in Germany.
Windelschreck.org has an IP Address of 134.119.45.93 and a hostname of akkawi.ispgateway.de and runs Server web server.



Windelschreck.org Web Server Information

Hosted IP Address:134.119.45.93
Hosted Hostname:akkawi.ispgateway.de
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Server

HTTP Header Analysis for Windelschreck.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Server
Content-Type: text/html;charset=UTF-8
Strict-Transport-Security: max-age=47474747;
Vary: Accept-Encoding,User-Agent,X-Amazon-CDN-Cache
Content-Language: de-DE
X-UA-Compatible: IE=edge
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
Content-Encoding: gzip
X-XSS-Protection: 1;
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
x-amz-rid: S1457TM2AMZFJM3V3TRW
Date: Fri, 19 Oct 2018 17:16:47 GMT
Transfer-Encoding: chunked
Connection: Transfer-Encoding


Need to find out who hosts Windelschreck.org?

Windelschreck.org Free SEO Report

Website Inpage Analysis for Windelschreck.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Windelschreck.org

typeofneuelive beikindledatebeginwindownavmettmpmotorraddatebeginwindownavmettmp windownavmettmpnewzumtvechojetzteinfachreturn1windownavbardeclareonloaddatezubei amazonfunctionelsevideohdneue firetestendauexldfireprefixuex functionschuhemillionen songswindownavlive bei amazonfrvarelse ifmusikfire hd2millionenfunction uexldsienewwindownavmettmpnewgerteesdiegwdesktopherotatortallarialsansserifbeiwbkostenlosemeinkaufswagenalleamp0wb 1iflivevonuexappskidssmartdarunter mitserien musikuexldmusicuexld prefix delimiterprefix delimiteruex function uexldmitfilmendarunter mit kostenlosemnowinhaltedelimiterausfalsemeinuexld prefixnbsphaushaltneue echoderneue fire hddarunterdatebeginwindownavmettmp windownavmettmpnew datekontosongsmehrprimeeinserienalexamit kostenlosemfontfamily arialsansserifdrogeriewindownavmettmpnew dategartenfontfamilycallbackberallamazonsie dieauf

Longtail Keyword Density for Windelschreck.org

KeywordsOccurences
uexld prefix delimiter4
uex function uexld3
datebeginwindownavmettmp windownavmettmpnew date3
live bei amazon3
darunter mit kostenlosem3
neue fire hd3
windownavmettmpnew date8
wb 17
uexld prefix4
prefix delimiter4
uex function3
bei amazon3
fire hd3
neue fire3
millionen songs3
mit kostenlosem3
darunter mit3
font-family arialsans-serif3
live bei3
serien musik3
function uexld3
sie die3
datebeginwindownavmettmp windownavmettmpnew3
else if3
neue echo3
sie24
amazon14
function14
mit14
var11
date11
zu9
09
datebeginwindownavmettmp8
gw-desktop-herotatortall8
if8
fire8
windownavmettmpnew8
fr8
prime7
neue7
17
windownav7
wb7
mehr6
apps6
alle6
video6
uexld6
delimiter6
serien5
music5
hd5
kindle5
alexa5
echo5
der5
return5
else5
motorrad4
false4
inhalte4
live4
windownavbardeclareonload4
kostenlosem4
jetzt4
zum4
prefix4
es4
dauexld4
schuhe4
testen4
die4
garten4
von4
haushalt4
nbsp4
smart3
darunter3
23
tv3
kids3
ein3
millionen3
songs3
auf3
uex3
berall3
mein3
now3
new3
aus3
gerte3
drogerie3
amp3
konto3
einfach3
typeof3
callback3
font-family3
arialsans-serif3
filmen3
musik3
bei3
einkaufswagen3

What are the nameservers for windelschreck.org?

Windelschreck.org Domain Nameserver Information

HostIP AddressCountry
ns2.namespace4you.com 193.223.77.3Germany Germany
ns.namespace4you.com 80.67.16.124Germany Germany

Windelschreck.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Windelschreck.org is a scam?