West Midlands Fire Service - Safer, stronger and healthier

Safety: Low trust score
Year Founded: 1999
Global Traffic Rank: 754,142
Estimated Worth: $1,680
Category: This site has not been categorized yet

West Midlands Fire Service is the second largest fire and rescue service in the country, delivering emergency response, education, prevention activities across the West Midlands.



Domain summary

Last updated
2021-11-12
Domain label
wmfs
Domain extension
net
Domain registered:
1999-07-06
Domain updated:
2020-02-24
Global Traffic Rank
754,142
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Frequently Asked Questions (FAQ)

Q: When was Wmfs.net registered?
A: Wmfs.net was registered 22 years, 4 months, 3 weeks, 1 day, 14 hours, 31 minutes, 46 seconds ago on Tuesday, July 6, 1999.
Q: When was the WHOIS for Wmfs.net last updated?
A: The WHOIS entry was last updated 1 year, 9 months, 4 days, 14 hours, 31 minutes, 46 seconds ago on Monday, February 24, 2020.
Q: What are Wmfs.net's nameservers?
A: DNS for Wmfs.net is provided by the following nameservers:
  • ns-1203.awsdns-22.org
  • ns-1563.awsdns-03.co.uk
  • ns-312.awsdns-39.com
  • ns-960.awsdns-56.net
Q: Who is the registrar for the Wmfs.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Wmfs.net?
A: Wmfs.net ranks 754,142 globally on Alexa. Wmfs.net has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Wmfs.net each day?
A: Wmfs.net receives approximately 1,167 visitors and 2,334 page impressions per day.
Q: What IP address does Wmfs.net resolve to?
A: Wmfs.net resolves to the IPv4 address .
Q: In what country are Wmfs.net servers located in?
A: Wmfs.net has servers located in the .
Q: What webserver software does Wmfs.net use?
A: Wmfs.net is powered by LiteSpeed webserver.
Q: Who hosts Wmfs.net?
A: Wmfs.net is hosted by Unknown in .
Q: How much is Wmfs.net worth?
A: Wmfs.net has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Wmfs.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wmfs.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wmfs.net

H1 Headings

0 :

H2 Headings

8 :
  1. Attacks on firefighters
  2. Sutton fire station also to be base for specialist rescue teams
  3. Safe and Well Survey
  4. Safety
  5. Staying safe at home, on the road, at work or in the garden
  6. Events
  7. Careers
  8. Become a firefighter with West Midlands Fire Service Visit our firefighter careers page

H3 Headings

6 :
  1. At home
  2. On the road
  3. Fire Safety
  4. In the garden
  5. All of our upcoming events are listed here. These include public events, such as Fire Authority meetings and ceremonies as well as events hosted by The Hub, our conference facility.
  6. Start a career with West Midlands Fire Service by visiting our external job board to check for vacancies.

H4 Headings

3 :
  1. Join WMNow today
  2. Language Translate:
  3. Privacy, terms, data and cookies

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-48043994-1

Links - Internal

56:

Links - Internal (nofollow)

0:

Links - Outbound

21:

Keyword Cloud for Wmfs.net

accesscompanycookie policyactivitiesread theirorganisational privacy0780c3srcdataproductsfire safetyfontface fontfamilyfunctionalitypageformatwoff2 fontfacerelatedemailvisityour paymentdisablingnumbersharedcircumstanceshomewe collectpurposepartymostautomaticallywesthas beendonottrackwinwtechnicalusesanyfacebookbelowpossiblenormalundefinedsearchcanwe onlyprivacymarketingrightgardensystemyearscontractreceiveimportantactcheckkeep your informationonlymidlands fire servicewe may useobligationstimefurthersave your preferencesoutlinedcommunityfire service websitequestionsinterestsmay process yourfontdisplayhandledmoredetailsfontstylecomplainchangesotherjqueryyour consentyour datagooglemore informationprovidedset outdisabling cookiesthemthese cookiespaymentformatwoff2 fontface fontfamilydevicelegalkeep youryou visitdoyour rightinformation webodywcollectedusedwe usecookies mayyour informationunderstandsummarycollectunlessdo notuse yourpersonalprocessingif wewindowrsmodulesyour personal informationsafetywebthroughcircumstances your rightwest midlandswindowrevapi8inittryenablenecessarygdpr cookiestrictly necessary cookiesour useaccordanceinformationmakeaccountroadorganisational privacy policyonlinedisclosepolicyif yousave yourwe may processfindsigncertain circumstances youryears of agelikeyou wekeepfontweightpartnersinformation youfirebeenrequestlocalrobotoaccessibilityinformation pleaseinformation be sharedlanguagenormal fontweightsitesall03300we do notcontact usgeneralnametracking technologiescookies and otherenable or disableourhave the rightthesepublicalsocageiffontdisplay swap srcwe haveprotectionask usdntshareshouldaddressyouveyourfunctiontheir privacy policyfontstyle normal fontweightoutanalyticscookies weyouright to asksourcesrespondreadwebsite privacy policypagesfontfamilyfire servicewellwe mayusewest midlands firesomecontentincludewe processfollowingreviewlinksuse the personalrequiredpolicieswe keepstoregreatprocess yourupdatedwe dofontdisplay swaptechnologiesspecificandortrackingour sitesummary weyou havedateusingfontfacemenunewnoconsentmayread their privacycertain circumstancesmidlandswe use cookiesguardianpreventdata protectionread articlewebsite privacyneedjames roundyour privacyhoweverrequirementswe keep yourpersonal information wepurposesupeventsusbestlongroundchildrenimproveexperiencenoticeuse your informationhelpcertainstayprotect yourcontacttermsprivacy policyyour preferencescookiesmidlands firegdprswaprightscareersstrictly necessaryconditionsprocessmeasuresprocess your datayou usetheirwwwwmfsnetour websitewebsiteyoutubesimilararticletranslationsosite10third parties18 yearssuch as yourdata wehavewe makesaveprovide to ussettingsinformation that youinformation in certainwhichcollect informationmay use yourfind outdisclose yourfontstyle normalchildren underdisclose your informationnewsinformation we collectinformation suchundertakenotlegitimateservicejameswindowrevapi8personal information youdo we usestrictlyother trackingpolicy weparentbasedyour personaldo we collectlocalmontserratlongerstoredonly sharepromotionalyour experiencecircumstances yourmay processrememberupdatesinformation please contactcookieyou makeaffectmarketing partnerspartiesgetgoogle analyticsvisit ourincludingnecessary cookiesdisable cookiesformatwoff2accessibleprovidedo wedocumentbodyclassnameaskbusiness purposesservice websitemobileinformation collectedfeaturespreferenceswe canorganisationalprotectplease contactlawwethirduse oursendother sourcesour sitesplease contact usstandardsafedatamanagerwmfsnetbusinesssetmay usepersonal informationcollect datado we keepwe only sharedisableswap srclocalralewayif you havecloseyou canbusinessescolorfulfildomainbrowserpleaseother tracking technologiesuse cookiesservicesavailablevarordersuchsecuritythirdpartyuse of cookieslegitimate businessversionhasmusttheir privacy

Longtail Keyword Density for Wmfs.net

KeywordsOccurences
your personal information19
west midlands fire13
midlands fire service13
have the right8
right to ask6
please contact us6
font-style normal font-weight6
font-display swap src6
we may use5
we keep your5
keep your information5
formatwoff2 font-face font-family5
organisational privacy policy4
personal information we4
information we collect4
do we collect4
do we use4
use your information4
information be shared4
we use cookies4
we may process4
do we keep4
we do not4
personal information you4
if you have4
their privacy policy3
years of age3
strictly necessary cookies3
website privacy policy3
information in certain3
certain circumstances your3
circumstances your right3
save your preferences3
enable or disable3
read their privacy3
fire service website3
disclose your information3
process your data3
may process your3
we only share3
may use your3
such as your3
use the personal3
provide to us3
information that you3
information please contact3
other tracking technologies3
cookies and other3
use of cookies3
personal information33
privacy policy23
your information21
your personal19
we may19
west midlands14
do we14
we collect14
midlands fire13
fire service13
if you13
you have13
we use12
we have11
information we10
your data9
our website9
contact us9
summary we9
you can9
our sites8
your right7
use cookies7
third parties7
process your7
you visit6
do not6
use your6
information you6
your consent6
normal font-weight6
swap src6
font-display swap6
keep your6
font-style normal6
font-face font-family6
may use6
your preferences6
cookie policy6
please contact6
data protection6
formatwoff2 font-face5
ask us5
google analytics5
we keep5
cookies we5
we do4
may process4
data we4
certain circumstances4
we can4
if we4
you use4
these cookies4
disabling cookies4
more information4
your privacy4
organisational privacy4
tracking technologies4
you make4
your experience4
strictly necessary4
read their3
their privacy3
service website3
has been3
children under3
18 years3
set out3
collect information3
circumstances your3
disclose your3
website privacy3
save your3
visit our3
disable cookies3
find out3
read article3
our use3
cookies may3
our site3
we only3
information please3
marketing partners3
other tracking3
james round3
collect data3
information collected3
your payment3
information such3
policy we3
other sources3
use our3
protect your3
we process3
legitimate business3
necessary cookies3
you we3
business purposes3
gdpr cookie3
we make3
only share3
fire safety3
we125
information109
your102
you100
our67
cookies45
us43
data40
policy37
use34
personal33
privacy31
may30
have28
if26
such25
do24
collect22
service21
website20
fire20
can19
other19
not18
sites17
contact17
any17
services15
right15
please15
site15
west14
midlands14
process13
cookie13
safety12
summary12
also11
all11
marketing11
read11
experience10
time10
make10
analytics10
necessary10
business10
which9
accessibility9
certain9
purposes9
preferences9
payment9
features9
home9
google9
third9
legal9
more9
consent9
out8
provide8
content8
safe8
processing8
keep8
set8
so8
security8
share8
collected8
rights8
pages7
include7
font-family7
visit7
var7
changes7
no7
request7
protection7
account7
enable7
parties7
following7
further6
only6
tracking6
undefined6
datamanagerwmfsnet6
need6
formatwoff26
them6
technologies6
font-face6
font-style6
address6
normal6
font-weight6
font-display6
swap6
src6
under6
disabling6
organisational6
page6
terms6
important6
ask6
most6
law6
specific6
events6
find6
name5
number5
take5
language5
online5
some5
05
required5
through5
contract5
using5
andor5
long5
similar5
web5
these5
improve5
provided5
access5
general5
browser5
order5
0780c35
email5
respond5
been5
functionality5
products4
save4
children4
disable4
shared4
age4
well4
used4
search4
interests4
disclose4
best4
circumstances4
automatically4
close4
menu4
legitimate4
receive4
policies4
based4
device4
careers4
sources4
uses4
public4
localraleway4
store4
their4
gdpr4
settings4
links4
prevent4
localmontserrat4
understand4
like4
below4
function4
new4
purpose4
protect4
standard4
localroboto4
partners4
c4
has4
domain4
third-party4
send4
updated4
strictly4
system4
however3
party3
fulfil3
remember3
measures3
promotional3
including3
years3
longer3
version3
parent3
dnt3
guardian3
unless3
mobile3
accordance3
obligations3
outlined3
documentbodyclassname3
technical3
community3
great3
conditions3
sign3
updates3
date3
up3
available3
garden3
road3
news3
article3
color3
round3
james3
stay3
check3
businesses3
youtube3
facebook3
13
bodyw3
winw3
windowrsmodules3
act3
must3
questions3
should3
stored3
activities3
handled3
youve3
complain3
do-not-track3
related3
possible3
wwwwmfsnet3
company3
requirements3
notice3
windowrevapi8inittry3
windowrevapi83
jquery3
033003
details3
translation3
get3
review3
help3
accessible3
affect3

Who hosts Wmfs.net?

Wmfs.net Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:LiteSpeed

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%

HTTP Header Analysis for Wmfs.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
X-DNS-Prefetch-Control: on
Content-Type: text/html; charset=UTF-8
Link:; rel=shortlink
Etag: "210332-1636672873;gz"
X-LiteSpeed-Cache: hit
Content-Encoding: gzip
Vary: Accept-Encoding
Content-Length: 47212
Date: Fri, 12 Nov 2021 07:05:13 GMT
Server: LiteSpeed
Alt-Svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000

Wmfs.net Domain Nameserver Information

HostIP AddressCountry
ns-1203.awsdns-22.org 205.251.196.179
ns-1563.awsdns-03.co.uk 205.251.198.27
ns-312.awsdns-39.com 205.251.193.56
ns-960.awsdns-56.net 205.251.195.192


Need to find out who hosts Wmfs.net?


Domain Registration (WhoIs) information for Wmfs.net

 Domain Name: WMFS.NET
Registry Domain ID: 7788993_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2020-02-24T15:37:24Z
Creation Date: 1999-07-06T14:47:39Z
Registry Expiry Date: 2028-07-06T14:47:39Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4165350123
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS-1203.AWSDNS-22.ORG
Name Server: NS-1563.AWSDNS-03.CO.UK
Name Server: NS-312.AWSDNS-39.COM
Name Server: NS-960.AWSDNS-56.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-11-11T07:18:38Z

Websites with Similar Names

Wmfs.info
WMFS.INFO - Win Moneys From Site Information
Wmfs.net
West Midlands Fire Service - Safer, stronger and healthier
Wmfs120.com
快乐赛车-源神怎么上雪山- [腾讯新闻]
Wmfsllc.com
Woods Mortgage & FInancial Services LLC

Recently Updated Websites

Patriotpointofsale.com (9 seconds ago.)Backtrader.com (10 seconds ago.)Heartofgahomes.com (10 seconds ago.)Arcadiaherbs.com (12 seconds ago.)Abscissas.com (15 seconds ago.)Webofstrength.com (16 seconds ago.)Marketingvideocompany.com (22 seconds ago.)Halocreditrepair.com (22 seconds ago.)Intermoneyinnovacion.com (25 seconds ago.)Bestbrand.in (27 seconds ago.)Negarwp.ir (28 seconds ago.)Agapihospitalitygroup.com (29 seconds ago.)Clutterworkshop.com (34 seconds ago.)Armishtravels.com (36 seconds ago.)Everton.jp (38 seconds ago.)T-kusuri.net (38 seconds ago.)Sacramentocourthouseconstruction.com (42 seconds ago.)Marquismusclesupplements.com (47 seconds ago.)Ucuzundan.com (48 seconds ago.)Snph2.com (48 seconds ago.)Connect2comm.com (49 seconds ago.)Fictiongenerator.com (50 seconds ago.)Kazps.com (52 seconds ago.)Ultrapremiumclients.com (53 seconds ago.)Boxlimited.com (56 seconds ago.)V-byte.com (1 minute 2 seconds ago.)Skingaming.com (1 minute 2 seconds ago.)Nestea.com.hk (1 minute 3 seconds ago.)Ozgurdusunce.net (1 minute 7 seconds ago.)Clinicasesteticas.com.br (1 minute 8 seconds ago.)

Recently Searched Keywords

pontiac firebird (1 second ago.)leicester fixtures and results (1 second ago.)świece do uszu (1 second ago.)tonfuncloadtsldsupdateslider function (1 second ago.)advanced focus dragon age inquisition (1 second ago.)5 4 3 2 1 lyrics (1 second ago.)list length python (2 seconds ago.)shingeki no kyojin season 3 (2 seconds ago.)petri (2 seconds ago.)gallery-slideshow-info info-element-title--itemfontslideshow italic (2 seconds ago.)typ 14 awg (2 seconds ago.)rfractaire (3 seconds ago.)watcher kdrama cast (3 seconds ago.)beautifull dressed ladies (4 seconds ago.)news+from+nowhere (5 seconds ago.)mobile platform (5 seconds ago.)аварийное отключение хвс по пр.мира,94 (5 seconds ago.)добровольное медицинское страхование (дмс) (6 seconds ago.)international long distance (6 seconds ago.)inferiorer infarkt (6 seconds ago.)california title 24 shower pans (7 seconds ago.)советы садоводам и виноградарям (7 seconds ago.)barrier free shower pan for tile (7 seconds ago.)mark tschirch (8 seconds ago.)教授风采 (8 seconds ago.)ada compliant tub showers (8 seconds ago.)app para ganhar dinheiro (8 seconds ago.)carteras para hombre (9 seconds ago.)100 chart topmarks (9 seconds ago.)google ai blog (9 seconds ago.)