Wohnideen, Möbel & Einrichtungstipps - wohn-welt.org

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-09-17
Domain label
wohn-welt
Domain extension
org
Domain registered:
2018-06-20
Domain updated:
2021-09-17
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Wohn-welt.org registered?
A: Wohn-welt.org was registered 3 years, 3 months, 3 weeks, 6 days, 23 hours, 21 minutes, 42 seconds ago on Wednesday, June 20, 2018.
Q: When was the WHOIS for Wohn-welt.org last updated?
A: The WHOIS entry was last updated 1 month, 23 hours, 21 minutes, 42 seconds ago on Friday, September 17, 2021.
Q: What are Wohn-welt.org's nameservers?
A: DNS for Wohn-welt.org is provided by the following nameservers:
  • ns5.kasserver.com
  • ns6.kasserver.com
Q: Who is the registrar for the Wohn-welt.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Wohn-welt.org?
A: Wohn-welt.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Wohn-welt.org each day?
A: Wohn-welt.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Wohn-welt.org resolve to?
A: Wohn-welt.org resolves to the IPv4 address 85.13.153.32.
Q: In what country are Wohn-welt.org servers located in?
A: Wohn-welt.org has servers located in the Germany.
Q: What webserver software does Wohn-welt.org use?
A: Wohn-welt.org is powered by Apache webserver.
Q: Who hosts Wohn-welt.org?
A: Wohn-welt.org is hosted by Neue Medien Muennich GmbH in Saxony, Loebau, Germany, 02708.
Q: How much is Wohn-welt.org worth?
A: Wohn-welt.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Wohn-welt.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wohn-welt.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wohn-welt.org

H1 Headings

1 :
  1. Wohnideen, Möbel & Einrichtungstipps

H2 Headings

6 :
  1. Gartenmöbel
  2. Kinderzimmer
  3. Badezimmer
  4. Büromöbel
  5. Wohnzimmer
  6. Heiz- und Klimageräte

H3 Headings

40 :
  1. Gartenmöbel
  2. Wohnzimmer
  3. Büromöbel
  4. Badezimmer
  5. Kinderzimmer
  6. Klimageräte
  7. Gartengarnitur
  8. Hollywoodschaukel
  9. Sonnenschirm
  10. Ampelschirm
  11. Hängematte
  12. Sonnensegel
  13. Strandkorb
  14. Solardusche
  15. Sonnenliege
  16. Kinder- schreibtisch
  17. Kinder- schreibtischstuhl
  18. Regendusche
  19. Duschregal
  20. Duschsystem
  21. Schreibtisch
  22. Höhenverstellbarer Schreibtisch
  23. Chefsessel
  24. Bürostuhl
  25. Schreibtischlampe
  26. Schlafsofa mit Bettkasten
  27. Esstisch mit Bank
  28. Sitzsack
  29. Heizlüfter
  30. Ölradiator
  31. Konvektor
  32. Luftreiniger
  33. Heizpilz
  34. IR Heizstrahler
  35. Luftbefeuchter
  36. Ventilator
  37. Heizkörperthermostat
  38. Infrarotheizung
  39. Mini-Klimaanlage
  40. Mobile Klimaanlage

H4 Headings

22 :
  1. Höhenverstellbarer Schreibtisch Test & Vergleich 2021
  2. Bester Schreibtisch 2021: Test, Vergleich & alle Infos
  3. Beste Schreibtischlampe 2021: Test, Vergleich & alle Infos
  4. Bester Bürostuhl 2021: Test, Vergleich & alle Infos
  5. Bester Kinderschreibtischstuhl 2021: Test, Vergleich & alle Infos
  6. Bester Kinderschreibtisch 2021: Test, Vergleich & alle Infos
  7. WC-Sitz mit Absenkautomatik 2021: Test, Vergleich & Alle Infos
  8. Bestes Duschsystem 2021: Test, Vergleich & alle Infos
  9. Bestes Duschregal 2021: Test, Vergleich & alle Infos
  10. Beste Regendusche 2021: Test, Vergleich & alle Infos
  11. Bestes Sonnensegel 2021: Test, Vergleich & wichtige Infos
  12. Bester Ampelschirm 2021: Test, Vergleich & wichtige Infos
  13. Bester Sonnenschirm 2021: Test, Vergleich & wichtige Infos
  14. Bester Strandkorb 2021: Test, Vergleich & wichtige Infos
  15. Bester Massagesessel 2021: Test, Vergleich & Alle Infos
  16. Bester Ohrensessel mit Hocker 2021
  17. Bestes Schlafsofa mit Bettkasten 2021: Top-6 Empfehlungen
  18. Bester Esstisch mit Bank und Stühlen 2021: Top 5 Empfehlungen
  19. Bester Ventilator 2021: Test, Vergleich & alle Infos
  20. Beste Heizlüfter 2021: Test, Vergleich & alle Infos
  21. Bester Ölradiator 2021: Test, Vergleich & alle Infos
  22. Bester Konvektor 2021: Test, Vergleich & alle Infos

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

63 :

Google Adsense

:
pub-0453969293352483

Google Analytics

:
UA-124265940-1

Links - Internal

57:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wohn-welt.org

overflow hiddenimportantlgnexthover crppopupfixedthemedarklgouterinheritimportant jquerywindowloadfunction10lazy falsedontcropimagelgouterrgba25525525505 borderborderbottom noneimportant15px 0px crppopupfullthemelightlgouterimportant colortop auto bottom1important fixedsizeframelgouter lgclosecrptile crptileinnercrphascustomlinkcrphasfblink iclinklineheight 32pxlgprevhover crppopupfixedthemelightlgouterdetails h3 gallery4entscheidetpadding 04emiclink gallery5 crptilehoverimportant gallery9 crptilegallery7 crptilecrpcontent3 crpcatalogwidgetitemrgba2552552550901960784314 important20px 2px mozboxshadow10pximportant maxheighttransparentlginnerfontsize 18px padding750pxuidialogtitlebarcrptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkgallery6 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkb3b3b3lgprev crppopupfixedthemedarklgouter lgactionssolid a90707important fixedsizeframelgouterbackgroundcolor fff crppopupfullthemelightlgouterlgclose backgroundcolor rgb2550 bottom autoimportanticlinkicfblink gallery4 crptilehoverlgtoolbar20px 0 05px important750px crppopupfixedthemelightlgouter lgclosetestvisibleimportant fixedsizeframelgouter lginnergray2px mozboxshadowlgbackdropcrp1popupbackdrop opacityurldataimagesvgxmlutf8 crpcontent6 crpcatalogwidgetitemheight 0backgroundcrpcatalogwidgetitem selecthover backgroundimagebackgroundcolor rgba0paddingtransparentimportant widthfalsecounter falseenableswipe falseenabledrag07 bordercolor 5c9b30 importantfff crppopupfullthemelightlgouter lgtooglethumbcolor 1e73beimportant bordercoloriclink gallery8 crptilehoverlgouter lgpagerouter10px 5pxbackgroundimage urldataimagesvgxmlutf8 crpcontent8screen cropping bodylgonp color inheritimportantgallery4 crptilecustomize overlay backgroundcrptile crptileinnercrphascustomlinkcrphaslnlinkftgfilters aselected30pxcolor b3b3b3 crppopupfixedthemedarklgoutercrppopupfixedthemelightlgouter lgactions lgnexthoverboldimportantvisibleimportantsolid b3b3b3 crppopupfullthemelightlgouterborderbottom 2pxlgsubhtmlbackgroundimage urldataimagesvgxmlutf8 crpcontent5lgnextlginner borderffffff crppopupfixedthemelightlgouter lgsubhtml1e73be gallery4ftgpages aselected coloriclinkiclnlink gallery9lg overflowlgiconhover colorcrptile crptileinner icsearchcolor cbcbcb crppopupfixedthemedarklgouter0 important backgroundcolorcrptile crptileinnercrpdetailsbg detailscrptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclink marginlefthiddenimportant crppopupthumbsgridlgouter lgthumb038iclinkiclnlink gallery6falsedownloadlgthumbitemactive0 fixedsizelgouterlgpagerthumbcont displayrgba2552552550901960784314trueactualsizecrppopupfullthemedarklgouter lgtooglethumb backgroundcolorcolor inheritimportanticlink gallery9 crptilehovercolor rgb66 66layouttype 3approxtilewidth 250approxtileheightmargin 1px crppopupfixedthemelightlgouteroverflowy scrollfixedsizelgouterlgcounterimportant boxshadow nonelgbackdropcrp1popupbackdropimportant paddingright0 backgroundcolor rgba000085auto bottom 0wpadminadminajaxphp2px 2pxa90707important fixedsizeframelgouternone important mozboxshadownone importantuiwidgetcontentariadescribedbycrpsuccessdialog7lgprevhovercenter margin 0uidialogtitlebarclosemarginlefticsearch i colorb3b3b3 width 45pxwpadminadminajaxphp var10pximportant var gkitnoprivajaxurllgtoolbar lgiconhoverinituidialogtitlebar uidialogtitlebarcloseopacity 1importantrgba0000000 gallery4important gallery8crptilehover cursorfalsefreeaddblocks falsemargin 4mintilewidthcrptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkicfblinkvar gkitnoprivajaxurllgbackdropcrp3popupbackdrop opacity 07importantimportant marginlefttruevideojs truecontrolscrptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkicfblink marginleftcrpcatalogwidgetgkitmobile880 height 91pximportantpadding 15pximportantfalseshare falsebackdropduration 10hidebarsdelaycrppopupfixedthemelightlgouter lgactions lgnextnichtzoom0px important marginright5px fixedsizelgouterlgactions lgprevhover crppopupfixedthemedarklgouterbackgroundimage urldataimagesvgxmlutf8 crpcontent3icsearch marginleft 20pxcookiesiclink gallery5zoom iconsmarginleft 5px importanticlink gallery7 crptilehovercrptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkiclnlink marginleft32pxuiwidgetcontentariadescribedbycrpsuccessdialog6mitkloadurlblankwichtigefontweight boldimportantoverlayr backgroundcolor rgba2552552550901960784314uiwidgetcontentariadescribedbycrpsuccessdialog5aselectedbefore backgroundcolordieicsearchbefore backgroundcolor5px important gallery8zindexnonedivnotcrpcatalogwidgeticlinkicfblink gallery307important lgbackdropcrp2popupbackdrop opacityh4crpprogressloaded borderbottom 2px3approxtilewidth 250approxtileheight 250addblock1heighticlink gallery3textalign left importantfalsefreeaddblocksfunction init functionopacitylgnexthover crppopupfixedthemelightlgouteralbumviewertypeisgrid 0b3b3b3 color b3b3b30 8px 0importanticlinkiclnlink gallery7 crptilehovercrptileinnercrphascustomlinkcrphaslnlink iclink marginleft1e73be bordercolorsettingscenterfunction init tile hoveruiwidgetcontentariadescribedbycrpproductenquirydialog8scroll lgouternoneimportant crppopupfullthemedarklgouter lgtooglethumbselecthover backgroundimage urldataimagesvgxmlutf8kviewerbackdropclass crp3popupbackdropbackgroundcolor rgba2552552550901960784314 importantnone important textdecorationbackgroundimage urldataimagesvgxmlutf8 crpcontent7padding 40px 5pxlgsubhtml backgroundcolor rgba255lgsubhtml position absoluteiclinkiclnlinktop 64pximportant bottomcrptilehover cursor pointeraselectedafter gallery807 importantftgfilters aselected color0 importantimportant paddingright 0pxgallery6 crptilehoverfrimportant marginright autoopacity 085importantlgsubhtml h4absolute textalign centersolid 5c9b30grey20px 20pxfixedsizeframelgouter lginner overflowiclinkiclnlink gallery5 crptilehoverlgcounter crppopupfullthemelightlgouter lgtoolbarlink zoomb3b3b3 crppopupfixedthemedarklgouter lgcloseuidialogtitlebar borderbottom 1pxrgb255border 1px solidcrptilehover crptileinnercrphasfblinkcrphaslnlink iclinkicfblink000000 gallery6lgnext backgroundcolor rgba255left topfixedsizelgouter lginner backgroundcolorscroll lgouter lgpagerouterlgiconfalsedontcropimage false kenablegridlazyloadlgiconhover crppopupfullthemelightlgouterlgthumbitem cursorheight 91pximportantcrptileinner icsearch marginleftcrptilehover crptileinnercrphasfblinkcrphaslnlink iclinkiclnlinkcbcbcbfloat rightfunctionfontweightcrptile crptileinner overlayreeeimportant paddingcrppopupfixedthemelightlgouter lgclose margin120 0 07lgactions lgprevhover crppopupfullthemelightlgoutertreffen255 07 importantlgcounter crppopupsimplethemelightlgouter lgtoolbargallery6 ftgfiltersicsearch marginleftbackgroundcolor noneimportant fixedsizelgouterautocolor b3b3b3rgba2552552550901960784314 important cusomizefixedsizeframebackgroundcolor rgba25525525507333333333330 bottom2falsebackdropduration 10hidebarsdelaycrppopupfullthemelightlgouter lgtooglethumbhover colorabsolute textalign leftuidialogtitlebar display noneimportanttextdecoration nonelinkobinputtypetexthover color0px mozboxshadowkeinegallery9 crptile crptileinnercrptilehover crptileinnercrphascustomlinkcrphasfblink iclinkicfblinkheight 0 fixedsizelgouterdetails paselectedafter gallery6crptileinner overlaytmarginleft auto0grey crppopupfixedthemelightlgouter lgactionstrueactualsize falsemode lgfadeaddclassiclinkicfblink gallery6crptileinnercrphasfblinkcrphaslnlink iclinkicfblinkgallery9 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink969696 bordercolor 969696crppopupfixedthemedarklgouter lgclose backgroundcolorcrppopupthumbsgridlgouter lgthumb padding0px important paddingleftcrppopupfullthemelightlgouter lgthumbouter lgthumbitemtile hovercropping bodylgon textalignimportant mozboxshadow10right background none470pxzoom falsedownloadwichtige infosbesterbackgroundimage urldataimagesvgxmlutf8crppopupfixedthemelightlgouter lgtoolbar lgiconhoverwidth 100pxfontweight normal removecrptile details h3bottom 0 fixedsizeframelgoutercrpcontent6 crpcatalogwidgetitemfalsecrppopupfixedthemedarklgouter lgtoolbarahoverafter20px 2pxaselectedafter gallery45px important gallery52px boxshadowcusomize link zoomtruevideojs truecontrols trueactualsizecrptileinnercrphascustomlinkcrphasfblink iclinkicfblink marginleftcrptilehover crptileinnercrptileinner overlayrinputtypetext color 969696importantcolor fff crppopupfixedthemelightlgouter4pxborderbottomcrpprogressloadedcrptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkiclnlink04em outline4px 0 backgroundcolornoneimportant crppopupfullthemelightlgouterlgthumbopen lgthumboutermozboxshadow none important303030 crppopupfixedthemelightlgouterlgsubhtml crppopupfullthemelightlgouter0px 0 0backgroundcolor rgba000085aselectedafter gallery3crptileinner icsearchafteruiwidgetcontentariadescribedbycrpproductenquirydialog4gallery9 ftgpagescrppreloader crpprogressloadedcrppopupsimplethemelightlgouter lgactions lgnextmediamaxwidth 750pxdivnotcrpcatalogwidget crpcatalogwidgetitemlgprevhover crppopupfixedthemelightlgouter lgactionsiclinkicfblink gallery8 crptilehover1 kdisablealbumstylepresentation 0lgimgwrap padding1e73beimportant bordercolor 1e73beimportant10hidebarsdelayfalsefreeaddblocks falsemargincrptileinnercrpdetailsbgportfolio options255 0crptilehover crptileinnercrphascustomlinkcrphasfblink iclinklgclose margin 0pxmarginright auto importantftgpages aselectedaftercookiebodylgonfontsize 18pxcrppopupfullthemelightlgouter lgactions lgnext1 kloadurlblank 1iclinkiclnlink gallery9 crptilehovermargin 1pxftgfilters ahoverbeforecrppopupfixedthemedarklgouter lgactions lgprevhover07 webkitboxshadowlgouter lgpagerouter topportfoliocrpwrapper width 1001e73be gallery7lgtooglethumb3approxtilewidth 250approxtileheightauto important marginrightcrptileinner overlay0 8pxaselectedafter gallery5ftgfilters aselectedafterlginner padding999important crppopupfullthemelightlgouteroverflow visibleimportant038 wichtigebottom2px 2px 20pxconfiguration goes hereimportant gallery6 ftgpages9999999 fixcrppopupfullthemelightlgouter lgtoolbar backgroundcolorcrptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkicfblinkfalseautoplayfirstvideolgicon crppopupfullthemelightlgouterpadding 04em outlinetop 64pximportantcrppopupfixedthemelightlgouter lgactionstextalign left topgallery5 ftgpagescrpcontent7 crpcatalogwidgetitemfalsethumbnail falsecounter falseenableswipebordercoloriclink marginleft 20pxpadding 40pxftgpages aselectedbefore backgroundcolornormallgprevhover crppopupfullthemelightlgouter lgactionstop 0crppopupsimplethemelightlgouter lgsubhtmlfalsedownload falsefullscreengallery3 ftgfilters303030 crppopupfixedthemedarklgouter lgactionsvisibleimportant fixedsizeframelgouterbackgroundcolor transparentbackgroundcolor rgba25525525505 bordergallery5 crptilehoverimportant color 000000303030important crppopupfixedthemelightlgouter lginnercbcbcb crppopupfixedthemedarklgouterlgclosehover crppopupsimplethemelightlgouter lgactionsiconwebkitboxshadow grey250approxtileheighticlinkicfblink gallery8solid eeeimportantsolid 5c9b30 importantfalsemargin 4mintilewidthrgba255255255073333333333318pxcrptileinner iclink marginleftnoneimportant crppopupfullthemedarklgoutercrppopupfixedthemelightlgouter lgactions lgprevhoverfalsebackdropduration 10hidebarsdelay 100000lgnext backgroundcolorimportant gallery9bottom 0hashmarginleft 5pxlgnexthover crppopupfixedthemedarklgouter lgtoolbarcolor ffffff crppopupfixedthemelightlgouterlgpagerouter top 64pximportantcustomizations customizecenter fontsize 30pxtextalign center margin66 crppopupfullthemelightlgouter lgsubhtmllgnexthover crppopupfullthemelightlgouter lgtooglethumbhoversolid gray crppopupsimplethemelightlgouterlgactions lgnexthover crppopupfullthemelightlgouter0px important paddingrightgallery9crppopupfullthemelightlgouter lgcounter9999999 fix screen15pxfalsefullscreen falseautoplaycontrols falsepager20px important gallery7float0 071uiwidgetcontentariadescribedbycrpproductenquirydialog3var gkitnoprivajaxurl wpadminadminajaxphpb3b3b3 colorftgpages ahoverbeforeright backgroundiclinkicfblink gallery6 crptilehover0 fixedsizeframelgouter45pximportant gallery5 crptiledetails h3 colorcolor 969696important bordercolor700pxheightimportant gallery507 important marginoverflowy250approxtileheight 250addblock1height falseaddblock2height15px 0pxsolid 000000maxheight 250pxfffcbcbcb fixedsizeframelgouterimportant backgroundcolor rgba255lgthumbitemremove link iconiclinkiclnlink gallery4crpcatalogwidgetitem marginleft 0pxlg overflow visibleimportantselect backgroundimagegkitnoprivajaxurl0 07 bordericlink marginleft 45pxfalsepager falsethumbnail falsecounterlgprevhover crppopupfixedthemedarklgouterfff crppopupfixedthemelightlgouteraselectedafterftgpages ahoveraftergallery3 crptile crptileinnereeeimportant303030 crppopupsimplethemelightlgouter lgsubhtmlimportant paddingleftpaddingright 0pxglobal function initlayouttype 3approxtilewidth0important lgpagerthumbcont displayfalseenabledraginputtypetext colorcboxoverlay zindex 9999999uidialogtitle fontweightheight 45pxlgtoolbar lgclosehoverbordercolor 969696 textdecorationsolid b3b3b3rgba2552552551 important colorcrptile crptileinner icsearchbeforeiclinkiclnlink gallery3lgbackdropcrp2popupbackdropfixedsizelgouter lgsubhtml positionvergleich 038 alletruecontrols trueactualsizemozboxshadow grey 2pxkdisablealbumstylepresentation 0color 1e73beimportantcrptile crptileinnercrphasfblinkcrphaslnlink iclinkicfblinkgartenmbel000000 gallery3 crptilecrppopupfullthemelightlgouter lgthumbouter lgthumbitemactivefalsemode lgfadeaddclass fixedsizeframegallery6 crptilefalseenableswipe falseenabledrag falsesharergba25525525505 border 1pxcrptileinnercrpfixexploreiconpos icsearch marginleft250addblock1height falseaddblock2height falsefreeaddblockslgactions lgprev32px fontweight normalnormal remove linkcolor 969696importantoverflowy scroll lgouterfixedsizeframelgouter lginner padding969696 bordercolorleft top autolgthumbouter backgroundcolortruevideojsimportant marginoptions configurationlgsubhtml colorcrptile crptileinnercrphascustomlinkcrphaslnlink iclinkpaddingleft 0px importantcrpcatalogwidgetitem inputtypetexthover colorlineheight 32px fontweight255 borderlgnext color1e73be bordercolor 1e73belgtoolbar lgiconuiwidgetcontentariadescribedbycrpsuccessdialog8lgtooglethumbhover colorinputtypetexthover backgroundimage urldataimagesvgxmlutf8gallery7 crptile crptileinnerurldataimagesvgxmlutf8 crpcontent6center fontsize969696important bordercolor 969696importantcrptileinnercrphascustomlinkcrphaslnlink iclinkiclnlinkcrptileinnercrphasfblinkcrphaslnlink iclinkiclnlink marginleftbackgroundcolor transparent heightgkitnoprivajaxurl wpadminadminajaxphpcustomize overlaylgfadeaddclass fixedsizeframecrppopupfullthemelightlgouter lgactions lgnexthoverdisplay none fixedsizelgoutercursor pointer importantfalseaddblock2height falsefreeaddblocksb3b3b3 color ffffffhover customizationsfixedsizeframelgouter lg overflowbackgroundimage urldataimagesvgxmlutf8 crpcontent9noneimportant lgthumbitemnew arraylgsubhtml h4 textalignfixedsizelgouter lgtoolbar lgiconcrpwrapper width45px important gallery6marginleft 45px importantlgnexthover crppopupfullthemelightlgoutergallery8 ftgpages91pximportantbottom autoimportantimportant widthimportantimportant marginleft autolgactionsalbumviewertypeisgridiclinkiclnlink gallery6 crptilehover085important lgbackdropcrp1popupbackdropcrppopupfullthemelightlgouter lgtoolbarfalseaddblock2height falsefreeaddblocks falsemargincrptileinnercrphascustomlinkcrphaslnlink700pxheight 470pxzoom falsedownload1e73be gallery9b3b3b3 widthcrpcatalogwidgetitem inputtypetext colorcrptileinner icsearchbeforecolor 969696 bordercolorcrppopupsimplethemelightlgouter lgcounter crppopupsimplethemelightlgoutercrptileinner icsearch backgroundcolorinputtypetext8px 0importantfixedsizeframelgouter lggallery3margin 20px 20pxlgtoolbar lgicon colorcusomize07 webkitboxshadow greyeinb3b3b3 crppopupfullthemelightlgouter lgtooglethumbcrppopupsimplethemelightlgouter lgactions lgprevhovercrpprogressloaded borderbottomfff crppopupfullthemelightlgoutercrptileinner overlaylborder 0pxbackgroundimage urldataimagesvgxmlutf8 crpcontent65px 10pxcolor 000000kinderzimmer424242 textalign centercrpcatalogwidgetgkitmobile880 heightallefix screengallery7 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkfalsebackdropduration200gridcellsize 10lazy falsedontcropimagecrpsmoothloadericlinkcrpcontent8 crpcatalogwidgetitemgallery9 crptilehover45px important gallery4falsemode lgfadeaddclassmozboxshadow grey 0pxgrey crppopupsimplethemelightlgouterpointer importantlgnexthover colorcrpcontent5303030 crppopupfixedthemelightlgouter lgactions20px important gallery8255 255 07rgba00005 crpfullpopuplgouterrgba0 0 02px crppopupfullthemelightlgouter lgthumbouter61e73beimportantcolor b3b3b3 widthfloat right background45px importantcrptileinnercrphascustomlinkcrphasfblink iclinknoneimportant fixedsizelgoutercrppopupfixedthemedarklgouter lgactions lgnextimportant colorboxrgba25525525505border nonepadding 4pxcrppopupfullthemedarklgouter lgtooglethumb10hidebarsdelay 100000important gallery31e73be gallery8rgba2552552550733333333333 important colorlgthumbouterpaddingtoplgthumbouter lgthumbitem bordercolor 1e73bebackground none fontsizekenablegridlazyloadtextalign center fontsizeimportant gallery4 crptilecolor cbcbcbcropping bodylgonrgb255 255 255margin 0px969696 textdecoration10pximportant varmarginleft auto importantcrptile crptileinner overlaylurldataimagesvgxmlutf8 crpcontent9 crpcatalogwidgetitemahoverbeforeiclinkiclnlink gallery3 crptilehover424242 textalignlgthumbouter lgthumbitemactive bordersolid b3b3b3 borderbottomlgthumbitem border 1pxfalsedontcropimage falseuiwidgetcontentariadescribedbycrpproductenquirydialog5lgprevhover crppopupsimplethemelightlgouter lgactionstest vergleichuidialogtitlebar displayhoverinfosbesteicsearchaftercrptile crptileinner icsearchafterlgsubhtml backgroundcolorgallery6 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink40px 5pxcrpcontent9inheritimportantfalsedownload falsefullscreen falseautoplaycontrols10lazy falsedontcropimage falseboxshadow nonecrpcontent63approxtilewidthfixedsizelgouter lgsubhtml p000000 gallery9cboxoverlay zindexnone border nonelgiconhover color 303030crpcontent4 crpcatalogwidgetitem000000 gallery9 crptilefixedsizeframelgouterwebkitboxshadow grey 0px0 important widthmarginleft 0pxwidth085importantbackgroundimage urldataimagesvgxmlutf8 crpcontent4important gallery3 crptilecrpcontent4background transparentimportant widthcrptileinnercrpfixexploreiconpos icsearchimpressum255 255 0maxheight 250px overflowyimportant paddingleft 0pxuiwidgetcontentariadescribedbycrpsuccessdialog4crpsmoothloader i color1e73befalseshare falsebackdropduration tilecolor ffffffimportant textdecorationmozboxshadow greylgactions lgprev crppopupfixedthemelightlgouter303030importantrgba255 255 2557crpcontent9 crpcatalogwidgetitemsolid a90707importantlgnext color cbcbcbiclink gallery3 crptilehoverabefore backgroundcolorzulassenlgtoolbar backgroundcolorfalsefullscreencrptile crptileinnercrphascustomlinkcrphasfblink iclinkicfblinklgclosehover crppopupsimplethemelightlgoutergallery4backgroundcolor rgba255outline none5px important gallery9backgroundcolor 1e73be303030 crppopupfixedthemedarklgouterwidth 40px height2pxgallery7jquerydocumentreadyfunctionuiwidgetcontentariadescribedbycrpproductenquirydialog7lgprevhover crppopupfixedthemedarklgouter lgactionsvar gkitpermalinkcrppopupsimplethemelightlgoutercrpclosebtn widthmediamaxwidthlgbackdropcrp3popupbackdrop opacity1px solid a90707importantkviewerbackdropclass20px 2px crppopupfullthemelightlgouter5c9b30gallery8 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink66 665px important gallery7gallery5 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinklginner backgroundcolor noneimportantcolor 000000 gallery5auto importantrgba2552552551 importantcrppopupfullthemelightlgouter lgactions lgprevhoverhash falseautoplayfirstvideopointerbadezimmerlgicon crppopupfullthemelightlgouter lgactionspaddingleft 0pxuiwidgetcontentariadescribedbycrpsuccessdialog93crpsubmitbtncrppopupfullthemelightlgouter lgsubhtml color66 66 crppopupfullthemelightlgoutercrppopupthumbsgridlgoutervergleich 038crptile crptileinnercrphasfblinkcrphaslnlinkfalseenableswipe falseenabledrag07 color graycrppopupfixedthemelightlgouter lgsubhtml colorlgclose marginmozboxshadow nonelgiconhover crppopupfullthemelightlgouter lgactionsgallery7 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink0 kviewerbackdropclass crp3popupbackdropcenter fixedsizelgouter lgsubhtml40px height 40pxheightimportant gallery7lgtoolbar backgroundcolor rgba255background none000000 gallery6 crptile8pxborderbottom 1px solid5c9b30 importantauto bottomlgthumbouter backgroundcolor fff2px 20px200gridcellsizegallery3 crptilehover13lgtooglethumb backgroundcolor rgba00005b3b3b3 borderbottommarginright autoimportant gallery9 ftgpagesffffff width64pximportantsolid eeeimportant paddinggallery9 ftgfilterskdirectlinking 1gallery8 crptileopacity 1important fixedsizeframelgoutercrp3popupbackdropcrptile detailsfalsepagerdivnotcrpcatalogwidget crpcatalogwidgetitem marginleftcrppopupfullthemelightlgouterlgthumbopen lgthumbouternoneimportant lgthumbitem cursoricsearchbefore backgroundcolor rgba2552552551crpfullpopuplgouterftgfilters aaftergoescursorlgtooglethumb crppopupfullthemelightlgouterbordercolor 1e73beftgfilters ahoverahoverfalse kenablegridlazyload 0crppopupfixedthemedarkwidthbackgroundcolor rgba2552552551transparent heightcrpcontent5 crpcatalogwidgetitemlgthumb padding 10pximportantcrppopupsimplethemelightlgouter lgactions lgnexthoverarray64pximportant bottom4mintilewidth 200gridcellsizescreengray border 1pxb3b3b3 crppopupfixedthemedarklgouter20px importantkloadurlblank 1 kdisablealbumstylepresentationnone fixedsizelgouter255 0 bordergrey crppopupsimplethemelightlgouter lgactionscolor 424242outline none borderlginner padding 4pximportant colorbox cboxoverlaycustomizations customize overlaywidth 50lgtoolbar backgroundcolor transparenticsearch backgroundcolor rgba2552552550733333333333tileimportant margin 1pxinfosbestescrptile crptileinner overlaybtrueactualsize falsemode1important fixedsizeframelgouternormal removeiclink gallery6 crptilehover470pxzoomcolor 1e73be bordercolorgallery3 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkftgfilters aselectedbeforebackgroundcolor fff webkitboxshadowcustomizegray crppopupsimplethemelightlgouter lgtoolbarcrptileinnercrphascustomlinkcrphasfblink iclink marginleftbackgroundcolor rgb255 2550 kdirectlinkingcrpclosebtn width 100pxcolorcrppopupfullthemelightlgouterlgthumbopennurcrptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkcenter margingallery7 ftgfiltersftgpages abefore backgroundcolorposition absolute textalignlgtoolbar lgclosehover crppopupsimplethemelightlgoutercolor 303030margincrppopupfixedthemelightlgouter lgactions lgprevoverlaynone borderlgfadeaddclassurldataimagesvgxmlutf8 crpcontent4100 importantuidialogtitlebarclose float rightgallery9 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkurldataimagesvgxmlutf8 crpcontent7 crpcatalogwidgetitemcrppopupfixedthemelightlgouter lginner backgroundcolorrighturldataimagesvgxmlutf8 crpcontent3aselected colorgallery6 ftgpagesgallery5 crptileoverflowremovegrey crppopupfixedthemelightlgouter10px 5px fixedsizelgouterinputtypetexthover000000 gallery3crppopupsimplethemelightlgouter lgtoolbarinputtypetext backgroundimage45px important gallery50px 15px 0px0 kviewerbackdropclasscrppopupfullthemelightlgouter lgactionsp color45px important gallery9crptile crptileinner iclinkrgba000085 fixedsizelgouter lgsubhtmlrgba0 0display none11rgb255 255b3b3b3 borderbottom noneimportantcrppopupfullthemelightlgouter lgtoolbar lgiconhover1px solid graypaddingright0px crppopupfullthemelightlgouterh4 textaligncrp3popupbackdrop albumviewertypeisgridmarginleft 30px importanticlink marginleftlginner lgimgwrap paddingfalsefullscreen falseautoplaycontrolscolor inheritimportant jquerywindowloadfunctionkloadurlblank 1newlgcloseiclinkicfblink gallery7 crptilehovercrppopupfixedthemedarkwidth 700pxheighticons2021 test vergleichgkitconfiguregridoptions configuration goesimaselectedbeforecrptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkgallery3 crptile4px 0backgroundcolor15px 0px boxshadowcrptilehover crptileinnercrphascustomlinkcrphaslnlink iclinkiclnlinkcrppreloader crpprogressloaded borderbottom30px lineheight 32pxbackgroundcolor rgba255 255urldataimagesvgxmlutf8 crpcontent3 crpcatalogwidgetitemgallery4 crptile crptileinnertop autoiclinkicfblink gallery4crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkiclnlink0 bordercolor rgb66layouttypeoverlayr backgroundcolor18px paddingcolor cbcbcb fixedsizeframelgoutertop 0 bottomcrptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkicfblinktextalignfff webkitboxshadowcrppopupsimplethemelightlgouter lgsubhtml crppopupfullthemelightlgouterftgfilters ahoverafter5px important gallery6solid 000000 colorarray varimportant lgbackdropcrp3popupbackdrop opacityfixedsizeframelgouter lginnergallery3 ftgpagesurldataimagesvgxmlutf8 0 fixedsizelgouter lgtoolbarob man sichftgpagesftgpages aafterselect backgroundimage urldataimagesvgxmlutf8crppopupsimplethemelightlgouter lgactions lgprev000000 gallery5gallery6 crptile crptileinnerlgclose backgroundcolor rgba0lineheightfalsesharecrpcatalogwidgetitem marginleftuidialogtitleimportant marginright0px boxshadow greyvergleich 038 wichtigelginner backgroundcolor ffflgclosehover303030 crppopupsimplethemelightlgoutercolor 424242 textalignodercrppopupfullthemelightlgouter lgactions lgprevpadding 10pximportantgallery8 ftgfiltersmozboxshadowsolid grayfalsecounter falseenableswipeiclinkiclnlink gallery8color grey crppopupsimplethemelightlgouter1important0px crppopupfullthemelightlgouter lgactions100 important marginleftimportant textdecoration noneimportantlgprev crppopupfixedthemelightlgouterboxshadow grey 2pxopacity 085important lgbackdropcrp1popupbackdropcrptileinnercrphasfblinkcrphaslnlink iclinkiclnlinkfixedsizelgouter lgsubhtmlgray crppopupsimplethemelightlgouter lgcounterlgsubhtml p displayimportant color greybackgroundcolor rgba25525525505lgactions lgprev crppopupsimplethemelightlgouter4mintilewidthlgprev crppopupfullthemelightlgouter lgactionsaselectedafter gallery9marginleft 70px important07 border 1px250px overflowy2px crppopupfullthemelightlgoutercrptilehover crptileinnercrphasfblinkcrphaslnlinkwidth 40pxcrppopupfixedthemelightlgouter lgclose backgroundcolorkenablegridlazyload 0crptile crptileinnercrpfixexploreiconpos icsearchaaftercrptileinnercrpfixexploreiconpos1 kloadurlblankftgfilters abeforecolor 303030 crppopupfixedthemedarklgoutercrptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinklgnexthover crppopupfixedthemelightlgouter lgtoolbarftgfilters abefore backgroundcolorlgtoolbar lgicon crppopupfullthemelightlgoutergallery3 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkuiwidgetcontentariadescribedbycrpsuccessdialog3lgtooglethumbhovertransparent height 0marginleft 30pxfalseautoplayfirstvideo truevideojs truecontrolscrppopupfixedthemelightlgouter lgsubhtml backgroundcolortextalign center fixedsizelgoutertopgallery4 crptile detailsfff crppopupfixedthemelightlgouter lginner255 071e73be gallery6details h3crpcontent8lgimgwrap padding 40px20px important gallery5transparentimportant width 50details p colorlgh3 gallery4 crptile45px paddingtop 10pximportanth3 colorurldataimagesvgxmlutf8 crpcontent9paddingleftgkitnoprivajaxurl wpadminadminajaxphp varlgprevhover crppopupsimplethemelightlgouter30px lineheight0 hash falseautoplayfirstvideoremove linkeinerfalseenableswipepadding 0 00000000px 0px 0screen cropping085important lgbackdropcrp1popupbackdrop opacitycrptile crptileinnercrphasfblinkcrphaslnlink iclinkiclnlinkkenablegridlazyload 0 kdirectlinkinglgtoolbar lgiconhover crppopupfullthemelightlgouterid04emlgpagerouterselectpaddingtop 10pximportant crppopupfixedthemedarklgouter5pximportanta90707important fixedsizeframelgouter lgimgwrapborderbottom 1pxzindex 9999999 fiximportant gallery7 ftgpagesiclinkiclnlink marginleft 30pxfalsemargin 4mintilewidth 200gridcellsizelgactions lgnext backgroundcolordetails backgroundcolor rgba2552552550901960784314rgba2552552551alle infosbestericlinkicfblink marginleft 20pxp color 424242lgnexthover color 303030h3 color 424242rgba00005function id settingswebkitboxshadow none important000000 gallery7 crptilehiddenimportantcrptileinnercrpdetailsbg details0px solid b3b3b3lgicon color graylgprevhover crppopupfullthemelightlgouter0 0 importantcolorbox cboxoverlay000000 colormarginleft 70pxiclinkiclnlink marginleftpaddingtop 10pximportant038 wichtige infosbestergallery8 crptilehoverlgtooglethumb backgroundcolor4configuration goesnew array varvoncrp3popupbackdrop albumviewertypeisgrid 0250px overflowy scrollcolor 303030important1px solid b3b3b3iclinkicfblink gallery9init functioncustomizationsiclinkicfblink marginleft 5pximportant mozboxshadow noneboxshadow greylgthumbouter lgthumbitem20px important colorbox40px 5px 10pxiclink gallery4zuaselectedcolor 303030 crppopupsimplethemelightlgouterpcrppopupsimplethemelightlgouter lgactionsposition0px importantbackgroundimage urldataimagesvgxmlutf8 gallery8rgba255crpcontent3marginleft 45pxlginner border 1pxfalsemodefalseautoplaycontrols falsepager0 fixedsizeframelgouter lginnericlink gallery6lgsubhtml color 303030importantbackgroundcolor 969696falsethumbnail falsecountercrptileinnercrphascustomlinkcrphasfblink iclinkicfblinkoverlaybgallery4 crptilehoverlgactions lgnexthover crppopupfixedthemedarklgouterselecthover backgroundimage250pxlgactions lgprevhover crppopupsimplethemelightlgouter1px solidlgsubhtml color 303030color 000000 gallery3iclinkbeforebackgroundimage999important crppopupfullthemelightlgouter lgthumbouteraselectedafter gallery7webkitboxshadow1px solid 0000000important lgpagerthumbcontob mancolor 000000 gallery4lginner overflow hiddenimportantlgprev crppopupfixedthemelightlgouter lgactionsnone fontsizeiclinkafter303030important crppopupfixedthemelightlgouteroptionsfontsize 30pxcolor 9696962px 20px 2pxcrptilehover crptileinnercrphascustomlinkcrphaslnlink iclinkoverflow hiddenimportant crppopupthumbsgridlgouterfalseautoplayfirstvideo truevideojs1px crppopupfixedthemelightlgouter lgsubhtmlcrppopupfullthemelightlgouter lgthumbouterlgthumbitemactive bordercusomize linkcrppopupfullthemelightlgouter lgcounter crppopupfullthemelightlgouterftgfilters20px 20px 0colorbox20px important gallery61px038 alle infosbesteslgthumbitemactive border 1px04em outline nonemanauswahlglobal functionhash falseautoplayfirstvideo truevideojscbcbcb crppopupfixedthemedarklgouter lgactions700pxheight 470pxzoom4mintilewidth 200gridcellsize 10lazycrptile crptileinner iclinkbefore5color 000000 gallery6 tiletextdecoration noneimportant20px important gallery3autoimportant mediamaxwidth70pxheight 45px paddingtopcrptileinnerpointer important lgbackdropcrp3popupbackdropmarginright 0pxwidth 45pxcursor pointercolor gray crppopupsimplethemelightlgouterlgcounter crppopupsimplethemelightlgouterwebkitboxshadow noneborder 1px15px 0px mozboxshadowftgpages floatcrppopupfixedthemelightlgouter lginnergallery7 crptilehoverlgtooglethumbhover color rgb6610pximportant maxheight 250px999important0745px important gallery7crppopupfullthemelightlgouter lgtoolbar lgicon2px boxshadow greycolor 000000 gallery7height 40px paddingtop100pxurldataimagesvgxmlutf8 crpcontent7important gallery3 ftgpagescolor 303030important crppopupfixedthemelightlgouter1px solid 999importantcrppopupfixedthemedarklgouter lgclose margin255 255 bordercrptilehover crptileinnercrphascustomlinkcrphaslnlink40px heightcrppopupsimplethemelightlgouter lgtoolbar lgclosehoverlgactions lgnexthoverdetails64pximportant bottom autoimportanttextdecoration none importantcrppopupfixedthemelightlgouter lginner bordericlinkiclnlink gallery8 crptilehovercrppopupfixedthemedarkwidth 700pxheight 470pxzoom20px 0lginner overflow038 allelgtoolbar lgiconhover colorleft importantmaxheightcrpcatalogwidgetitem470pxzoom falsedownload falsefullscreenlgactions lgprevhover crppopupfixedthemelightlgoutercrptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkuiwidgetcontentariadescribedbycrpproductenquirydialog9iclinkicfblink marginleftimportant gallery5 ftgpagesalle infosbesteiclinkicfblink gallery9 crptilehoverbackgroundcolor fff1e73beimportant bordercolorinputtypetext backgroundimage urldataimagesvgxmlutf8marginleft 20px importantmarginleft 0px importantcrptileinnercrphascustomlinkcrphaslnlink iclinkrgba000085 fixedsizelgouterurldataimagesvgxmlutf8 crpcontent4 crpcatalogwidgetitemimportant lgbackdropcrp3popupbackdropjquerywindowloadfunctionlgsubhtml positioncolor 000000 gallery8crppopupfullthemelightlgouterlgthumbopen lgthumbouter backgroundcolorp display noneautoimportant0 hash250addblock1height falseaddblock2height20px 2px boxshadow2px solid 5c9b30bottom autoimportant backgroundlgactions lgnext coloropacity 07important lgbackdropcrp2popupbackdroprgba000085test vergleich 038boxshadow none importantuiwidgetcontentariadescribedbycrpproductenquirydialog6crpwrapperrgba2552552550733333333333 importantmarginleft 20pxlgsubhtml crppopupfullthemelightlgouter lgtoolbarheight 40pxlgbackdropcrp2popupbackdrop opacityh3 gallery4autoimportant backgroundcrpcatalogwidgetitem inputtypetext backgroundimagetextalign leftfalsemarginconfigurationcrppopupfixedthemedarklgoutercrppopupfixedthemelightlgouter lgcloseimportant cusomizeboxshadow grey 0px07importantcrptileinnercrphasfblinkcrphaslnlink iclinkicfblink marginleftnbspcrpcatalogwidgetitem inputtypetexthoverlgactions lgprevhoverbordercolor 1e73beimportant000000 color cbcbcb255 07 coloricsearch backgroundcolorimportant gallery8 ftgpagescboxoverlayabsolute5pximportant crppopupfixedthemelightlgouter2021 testcrppreloaderoutlinefix screen croppinglgthumbitem cursor pointercrpcatalogwidgetitem inputtypetext0px 0pxcrptileinnercrphasfblinkcrphaslnlinkcrpclosebtngrey 0px 0pxcrpcatalogwidgetgkitmobile880crppopupfullthemelightlgouter lgtooglethumbfalseenabledrag falseshare8bordercolor 969696importantrgb66 66sich0 auto1e73be gallery30px crppopupfullthemelightlgouter lgsubhtmlcrpcatalogwidgetitem selecticlinkicfblink gallery5 crptilehoverfixedsizeframelgouter lgimgwrapbackgroundcolor rgba00005255 border 1px969696important bordercolorb3b3b3 crppopupfullthemelightlgoutergrey 2pxpadding 4px 0crppopupfixedthemedarklgouter lgactions lgprevbackground transparentimportanturldataimagesvgxmlutf8 crpcontent5ffffff crppopupfixedthemelightlgouterkdisablealbumstylepresentation 0 kviewerbackdropclassiclinkiclnlink gallery4 crptilehoverwidth 100globalcrptileinnercrpdetailsbg details backgroundcolorlgicon colorcolor 303030 crppopupfixedthemelightlgouterlgprev crppopupfixedthemedarklgouterffffff width 45pxftgpages abeforeh3margin 20pxlgactions lgprev crppopupfixedthemedarklgoutergallery65px important gallery4crptile crptileinnercrpdetailsbgbottom autoimportant mediamaxwidth45px height 45pxpadding 0width 45px heightoverlayrabefore backgroundcolor 969696lgbackdropcrp3popupbackdropcrptileinnercrphascustomlinkcrphaslnlink iclinkiclnlink marginleftcrppopupfullthemelightlgouter lgsubhtmlwebkitboxshadow grey 2px66 crppopupfullthemelightlgouterrgba255 255crptile crptileinnercrpfixexploreiconpos5pxportfolio options configurationcrptilehover crptileinnercrphascustomlinkcrphasfblinkinfosbesterfixcolor 5c9b30lgthumbitem border18px padding 04eminputtypetexthover backgroundimagelgsubhtml top 040px paddingtop 5pximportantuidialogtitle fontweight boldimportantgray bordercrptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkauchcrppopupfixedthemedarklgouter lgtoolbar lgiconhovericlinkicfblink marginleft 45pxfixedsizelgouter lgtoolbarsolid 999important crppopupfullthemelightlgouter32px fontweightfixedsizeframelgouter lgimgwrap paddingcrppopupthumbsgridlgouter lgthumb15pximportantnoneimportantcolor graylgactions lgnexthover crppopupfixedthemelightlgoutertruecontrolsid settingsdisplay noneimportant lgthumbitemwidth 100 importantftgpages aselectedcrptileinner iclinkbeforebackgroundcolor rgba2552552551 importanttile hover customizationslgsubhtml p20px important gallery9fixedsizeframelgouter lgclosefontsize 30px lineheight038 alle infosbestercropping10pxp displaykdisablealbumstylepresentation1e73be gallery51px solid eeeimportant10pximportant crppopupfixedthemedarklgouterimportant cusomize linkpaddingtop 5pximportant crppopupfixedthemelightlgouterlgthumb paddingbackgroundcolor rgba0 0lgprev crppopupfullthemelightlgouterfixedsizeframelgouter lgtoolbarrgb66 66 66noneimportant fixedsizelgouter lgsubhtml45px important gallery3solid 999importantkdirectlinking 1 kloadurlblankalbumviewertypeisgrid 0 hashiclinkicfblink gallery5textdecorationiclink gallery740pxautoimportant mediamaxwidth 750pxbodylgon textalignlgimgwrapselecthovercrptile crptileinnercrphascustomlinkcrphaslnlink iclinkiclnlinkmargin 0 autoopacity 07importantbackgroundcolor rgb255lgprevcrppopupfixedthemedarklgouter lgclosergb660 backgroundcolor10pximportanticsearchbeforegallery4 crptile crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkfalsecounterffffffabefore5px important gallery3falsepager falsethumbnailiclinkicfblink gallery3 crptilehovergallery8 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink255 255250approxtileheight 250addblock1heightkeine cookies20px important gallery470px important0px 0px 15px10lazycrptileinnercrphascustomlinkcrphasfblinkcrppopupfullthemedarklgouternoneimportant crppopupfullthemelightlgouterlgthumbopencolor grey250addblock1heightcrptile crptileinnercrphascustomlinkcrphasfblinklgactions lgnext40px paddingtoplink iconimportant gallery7 crptile0px 15pxbrombelmargin 0important width 40px0importantborder 0px solidfixedsizeframelgouter lgtoolbar backgroundcolorfalseautoplaycontrols falsepager falsethumbnailarray var gkitpermalink0 border 0pximportant gallery4 ftgpagesurldataimagesvgxmlutf8 crpcontent5 crpcatalogwidgetitemcrpcatalogwidgetitem inputtypetexthover backgroundimagetextdecoration noneimportant crppopupfullthemelightlgouterlgthumbopencolorbox cboxoverlay zindex0px solidimportant marginright 0pxfixedsizelgouter lginner000000 gallery5 crptile969696 textdecoration nonesie einegallery5 crptile crptileinnernone fontsize 18px2px mozboxshadow grey10pximportant crppopupfixedthemedarklgouter lgclosenone fixedsizelgouter lginner0 fixedsizeframelgouter lgtoolbarbackgroundcolor rgba2552552550901960784314falseaddblock2heighturldataimagesvgxmlutf8gallery4 ftgfilters1px crppopupfixedthemelightlgoutercrptileinner overlayballe infosbestesiclink gallery9lgiconhover color ffffffcrppopupfixedthemedarklgouter lgactions lgnexthovercrptile crptileinner overlayftgpages float right45px heightfalseenabledrag falseshare falsebackdropdurationpaddingright 0px importantdatenschutzerklrungftgpages a colorborder000000 gallery8 crptilefalsedontcropimagegallery5 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkpaddingtop 10pximportant vardisplay30px important000000 gallery7crptilehover crptileinner icsearchbodylgon textalign leftgallery7 ftgpagesimportant gallery6h4 textalign centeruidialogtitlebar uidialogtitlebarclose floatlgpagerouter topimportant boxshadowpadding 10pximportant maxheight5px 10px 5pxcrptilehover crptileinner iclinklgpagerthumbcont display noneimportantuidialogtitlebarclose floateeeimportant padding 15pximportantcrppopupfullthemelightlgouter lgsubhtml backgroundcolorfontsizefunction idtransparentimportantimportant gallery6 crptilecrptile crptileinner overlaytlgnext color greylgimgwrap padding 0crptile crptileinnercrptileinner iclinkafter0px 0crppopupfixedthemelightlgouter lgtoolbar5pximportant crppopupfixedthemelightlgouter lgcloseftgpages aselectedbefore200gridcellsize 10lazyiclinkiclnlink marginleft 5px000000 gallery4 crptilecrppopupfullthemelightlgouter lgtooglethumbhovercrptileinner icsearchmediamaxwidth 750px crppopupfixedthemelightlgouteroverlay backgroundhover customizations customizemargin 0px 0pxposition absolutecrppopupfullthemelightlgouter lgtooglethumb crppopupfullthemelightlgoutersolidpaddingtop 5pximportantlginner backgroundcolorfixedsizelgouter lgsubhtml h42px solidcenter fixedsizelgouterimportant backgroundcolorcrptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlink iclinkiclnlinkiclink gallery8038 alle infosbestebackgroundcolor rgba2552552550733333333333 importantb3b3b3 crppopupfullthemelightlgouter lgtoolbarumdetails backgroundcolor000000 gallery80px mozboxshadow greylgclose margin 20pxvarkviewerbackdropclass crp3popupbackdrop albumviewertypeisgridbackgroundcolor rgba000085 fixedsizelgoutergoes hereiclink gallery4 crptilehovermarginright 0px importantlgtooglethumb crppopupfullthemelightlgouter lgcounter8px 0important lgpagerthumbcontcbcbcb fixedsizeframelgouter lg255 07 webkitboxshadow20pxisticlink marginleft 70px750px crppopupfixedthemelightlgoutericlinkicfblink gallery7crppopupfixedthemedarklgouter lgactionscrptilehovercrptileinner icsearchbefore backgroundcolorlgprev crppopupsimplethemelightlgouterheight 0 fixedsizeframelgouter1 kdisablealbumstylepresentationlgsubhtml top0 kdirectlinking 1hiddenimportant crppopupthumbsgridlgoutercrppopupfullthemelightlgoutergray crppopupsimplethemelightlgouterfff webkitboxshadow grey255 07 borderzindex 20000aselected color 1e73beiclinkiclnlink gallery5overlaytimportant gallery4lgcounter crppopupfullthemelightlgoutercrpfullpopuplgouter lgtoolbarfontweight normalcrppopupsimplethemelightlgouter lgtoolbar lgiconlgthumbouter lgthumbitemactiveden969696importantcrppopupfixedthemelightlgouterfalse kenablegridlazyloadgallery4 ftgpagesiclinkiclnlink gallery7truecontrols trueactualsize falsemodefixedsizelgouter lgtoolbar backgroundcolorcolor grey crppopupfixedthemelightlgouterherelgthumbgkitpermalinkjquerydocumentreadyfunction gkitconfiguregridgallery5 ftgfilterssolid b3b3b3 colorftgpages ahovercrppopupsimplethemelightlgouter lgcounter07 important colora90707importantbackgroundcolor noneimportantlginner lgimgwrap0 0 8pxborderbottom noneimportant crppopupfullthemedarklgouterbackgroundcolor rgba00005 crpfullpopuplgouterbordercolor 969696crptileinner iclinkwohnideenlgactions lgprev crppopupfullthemelightlgouter45px important gallery8crptile details pman sichboxshadow0 0lgtoolbar a webkitboxshadowgallery8 crptile crptileinneraselectedbefore backgroundcolor 1e73becrppopupfullthemelightlgouter lgtooglethumb backgroundcolorlgiconhoververgleichgallery9 crptilecrpcatalogwidgetitem select backgroundimageurldataimagesvgxmlutf8 lgclose backgroundcolortextalign centerabsolute textalignlink zoom iconsurldataimagesvgxmlutf8 crpcontent8lgbackdropcrp1popupbackdrop opacity 1importantgrey 0pxleftftgfilters aselectedbefore backgroundcolor5px fixedsizelgouter lgtoolbargallery5init function idsiedisplay noneimportantrgba00005 crpfullpopuplgouter lgtoolbarcolor gray borderscrollautoimportant background transparentimportantlgbackdropcrp2popupbackdrop opacity 085importanticsearchlgtooglethumb backgroundcolor rgba255255255050px boxshadowderescolor ffffff widthwohnzimmerborderbottom 2px solidmbelfixedsizeframelgouter lgclose marginimportant gallery8 crptilezindex 9999999crppopupfixedthemelightlgouter lgsubhtmlurldataimagesvgxmlutf8 crpcontent8 crpcatalogwidgetitem0pxuidialogtitlebar borderbottominputtypetexthover color 1e73beimportantcolor 000000 gallery9crptilelgpagerthumbcontfalsethumbnailkdirectlinkinglgactions lgnexthover color07important lgbackdropcrp2popupbackdrop45px paddingtopgallery4 crptilehover crptileinnercrphascustomlinkcrphasfblinkcrphaslnlinkgrey 2px 2pxlgnexthovercrptileinner overlayr backgroundcolorcrpcontent7none important boxshadowoverflow visibleimportant fixedsizeframelgouterftgfilters a coloreineiclinkicfblinklgprev crppopupsimplethemelightlgouter lgactionsoverlaylfalseautoplaycontrols07 colormarginrightcrptile crptileinner iclinkaftercrpcatalogwidgetitem selecthovercolor fff9lgicon color fff

Longtail Keyword Density for Wohn-welt.org

KeywordsOccurences
rgba255 255 25556
border 1px solid56
background-color rgba255 25556
0px 0px 15px42
0px 15px 0px42
grey 0px 0px42
255 255 0742
- - -35
1px solid b3b3b328
margin-left -20px important28
2px 20px 2px21
margin-left -45px important21
0 0 important21
crp-tile crp-tile-inner ic-link21
crp-tile crp-tile-inner ic-search21
2px 2px 20px21
solid b3b3b3 color21
margin-left 5px important21
lg-next background-color rgba25521
lg-actions lg-next background-color21
grey 2px 2px21
2021 test vergleich18
test vergleich 03818
gallery-9 crp-tile crp-tile-inner15
gallery-8 crp-tile crp-tile-inner15
gallery-6 crp-tile crp-tile-inner15
gallery-3 crp-tile crp-tile-inner15
gallery-7 crp-tile crp-tile-inner15
gallery-5 crp-tile crp-tile-inner15
gallery-4 crp-tile crp-tile-inner15
255 0 border14
0px solid b3b3b314
border 0px solid14
15px 0px box-shadow14
-moz-box-shadow grey 0px14
32px font-weight normal14
0 border 0px14
text-align center font-size14
width 45px height14
45px height 45px14
height 45px padding-top14
45px padding-top 10pximportant14
box-shadow grey 0px14
15px 0px crp-popup-full-theme-lightlg-outer14
crp-popup-full-theme-lightlg-outer lg-actions lg-prev14
lg-actions lg-prev crp-popup-full-theme-lightlg-outer14
lg-prev crp-popup-full-theme-lightlg-outer lg-actions14
crp-popup-full-theme-lightlg-outer lg-actions lg-next14
0px box-shadow grey14
margin 0px 0px14
255 255 014
255 07 -webkit-box-shadow14
424242 text-align center14
color 424242 text-align14
lg-toolbar lg-icon color14
b3b3b3 color b3b3b314
ic-link margin-left -45px14
center font-size 30px14
solid b3b3b3 crp-popup-full-theme-lightlg-outer14
important color 00000014
font-size 30px line-height14
07 -webkit-box-shadow grey14
important background-color rgba25514
-webkit-box-shadow grey 0px14
30px line-height 32px14
line-height 32px font-weight14
15px 0px -moz-box-shadow14
background-color rgba2552552550901960784314 important14
lg-close margin 0px14
0px 0px 014
0px 0 014
0 important background-color14
ic-search margin-left -20px14
0px -moz-box-shadow grey14
07 border 1px14
969696 border-color 96969614
aselectedbefore background-color 1e73be14
1e73be border-color 1e73be14
color 1e73be border-color14
aselected color 1e73be14
abefore background-color 96969614
text-decoration none important14
969696 text-decoration none14
color 969696 border-color14
cursor pointer important14
transparent height 014
background-color transparent height14
lg-toolbar background-color transparent14
lg-sub-html background-color rgba25514
vergleich 038 alle14
position absolute text-align14
lg-sub-html position absolute14
255 07 important14
border-color 969696 text-decoration14
crp-close-btn width 100px14
lg-actions lg-next color14
ic-linkic-ln-link margin-left 5px14
lg-toolbar lg-iconhover color14
important gallery-9 crp-tile12
important gallery-4 crp-tile12
gallery-4 crp-tile details12
important gallery-5 crp-tile12
crp-tile details h312
important gallery-6 crp-tile12
important gallery-8 crp-tile12
important gallery-3 crp-tile12
important gallery-7 crp-tile12
crp-tile details p12
details p color12
crp-popup-full-theme-lightlg-outer lg-thumb-outer lg-thumb-item7
background-color rgba00005 crp-full-popuplg-outer7
-webkit-box-shadow none important7
background-color rgba25525525505 border7
rgba25525525505 border 1px7
solid 999important crp-popup-full-theme-lightlg-outer7
none important -moz-box-shadow7
lg-toogle-thumb background-color rgba255255255057
solid b3b3b3 border-bottom7
b3b3b3 border-bottom noneimportant7
crp-popup-full-theme-lightlg-outer lg-toogle-thumb background-color7
fff crp-popup-full-theme-lightlg-outer lg-toogle-thumb7
1px solid 999important7
lg-thumb-item border 1px7
lg-thumb-outer lg-thumb-item border7
lg-thumb-outer background-color fff7
2px crp-popup-full-theme-lightlg-outer lg-thumb-outer7
box-shadow none important7
fff -webkit-box-shadow grey7
-webkit-box-shadow grey 2px7
crp-popup-full-theme-lightlg-outerlg-thumb-open lg-thumb-outer background-color7
20px 2px -moz-box-shadow7
noneimportant crp-popup-full-theme-lightlg-outerlg-thumb-open lg-thumb-outer7
text-decoration noneimportant crp-popup-full-theme-lightlg-outerlg-thumb-open7
2px -moz-box-shadow grey7
important text-decoration noneimportant7
none important text-decoration7
-moz-box-shadow grey 2px7
crp-popup-full-theme-darklg-outer lg-toogle-thumb background-color7
20px 2px box-shadow7
border-bottom noneimportant crp-popup-full-theme-darklg-outer7
important box-shadow none7
lg-toolbar a -webkit-box-shadow7
lg-toogle-thumb background-color rgba000057
2px box-shadow grey7
none important box-shadow7
-moz-box-shadow none important7
important -moz-box-shadow none7
box-shadow grey 2px7
20px 2px crp-popup-full-theme-lightlg-outer7
noneimportant crp-popup-full-theme-darklg-outer lg-toogle-thumb7
background-color fff -webkit-box-shadow7
rgba00005 crp-full-popuplg-outer lg-toolbar7
portfolio options configuration7
background-color fff crp-popup-full-theme-lightlg-outer7
lg-actions lg-prev crp-popup-fixed-theme-lightlg-outer7
lg-nexthover crp-popup-fixed-theme-lightlg-outer lg-toolbar7
lg-actions lg-nexthover crp-popup-fixed-theme-lightlg-outer7
crp-popup-fixed-theme-lightlg-outer lg-actions lg-nexthover7
lg-prevhover crp-popup-fixed-theme-lightlg-outer lg-actions7
lg-actions lg-prevhover crp-popup-fixed-theme-lightlg-outer7
crp-popup-fixed-theme-lightlg-outer lg-actions lg-prevhover7
grey crp-popup-fixed-theme-lightlg-outer lg-actions7
color grey crp-popup-fixed-theme-lightlg-outer7
important color grey7
07 important color7
crp-popup-fixed-theme-lightlg-outer lg-actions lg-next7
lg-prev crp-popup-fixed-theme-lightlg-outer lg-actions7
crp-popup-fixed-theme-lightlg-outer lg-actions lg-prev7
lg-iconhover color 3030307
303030 crp-popup-fixed-theme-lightlg-outer lg-actions7
color 303030 crp-popup-fixed-theme-lightlg-outer7
lg-sub-html color 3030307
crp-popup-full-theme-lightlg-outer lg-sub-html color7
0px crp-popup-full-theme-lightlg-outer lg-sub-html7
options configuration goes7
66 crp-popup-full-theme-lightlg-outer lg-sub-html7
66 66 crp-popup-full-theme-lightlg-outer7
rgb66 66 667
color rgb66 667
lg-toogle-thumbhover color rgb667
crp-popup-full-theme-lightlg-outer lg-toogle-thumbhover color7
lg-nexthover crp-popup-full-theme-lightlg-outer lg-toogle-thumbhover7
crp-popup-fixed-theme-lightlg-outer lg-toolbar lg-iconhover7
color 303030 crp-popup-fixed-theme-darklg-outer7
lg-inner background-color fff7
crp-popup-fixed-theme-darklg-outer lg-toolbar lg-iconhover7
crp-popup-fixed-theme-lightlg-outer lg-inner background-color7
303030important crp-popup-fixed-theme-lightlg-outer lg-inner7
color 303030important crp-popup-fixed-theme-lightlg-outer7
lg-sub-html color 303030important7
crp-popup-fixed-theme-lightlg-outer lg-sub-html color7
1px crp-popup-fixed-theme-lightlg-outer lg-sub-html7
margin 1px crp-popup-fixed-theme-lightlg-outer7
important margin 1px7
07 important margin7
crp-popup-fixed-theme-lightlg-outer lg-sub-html background-color7
ffffff crp-popup-fixed-theme-lightlg-outer lg-sub-html7
color ffffff crp-popup-fixed-theme-lightlg-outer7
lg-iconhover color ffffff7
crp-popup-full-theme-lightlg-outer lg-thumb-outer lg-thumb-itemactive7
303030 crp-popup-fixed-theme-darklg-outer lg-actions7
lg-nexthover crp-popup-fixed-theme-darklg-outer lg-toolbar7
lg-actions lg-nexthover crp-popup-fixed-theme-darklg-outer7
crp-popup-fixed-theme-darklg-outer lg-actions lg-nexthover7
lg-prevhover crp-popup-fixed-theme-darklg-outer lg-actions7
lg-actions lg-prevhover crp-popup-fixed-theme-darklg-outer7
crp-popup-fixed-theme-darklg-outer lg-actions lg-prevhover7
cbcbcb crp-popup-fixed-theme-darklg-outer lg-actions7
color cbcbcb crp-popup-fixed-theme-darklg-outer7
lg-next color cbcbcb7
crp-popup-fixed-theme-darklg-outer lg-actions lg-next7
lg-prev crp-popup-fixed-theme-darklg-outer lg-actions7
lg-actions lg-prev crp-popup-fixed-theme-darklg-outer7
crp-popup-fixed-theme-darklg-outer lg-actions lg-prev7
999important crp-popup-full-theme-lightlg-outer lg-thumb-outer7
important width 40px7
lg-thumb-outer lg-thumb-itemactive border7
3approxtilewidth 250approxtileheight 250addblock1height7
10pximportant var gkitnoprivajaxurl7
var gkitnoprivajaxurl wp-adminadmin-ajaxphp7
gkitnoprivajaxurl wp-adminadmin-ajaxphp var7
new array var7
array var gkitpermalink7
layouttype 3approxtilewidth 250approxtileheight7
250approxtileheight 250addblock1height falseaddblock2height7
ffffff width 45px7
250addblock1height falseaddblock2height falsefreeaddblocks7
falseaddblock2height falsefreeaddblocks falsemargin7
falsefreeaddblocks falsemargin 4mintilewidth7
falsemargin 4mintilewidth 200gridcellsize7
4mintilewidth 200gridcellsize 10lazy7
200gridcellsize 10lazy falsedontcropimage7
padding-top 10pximportant var7
color ffffff width7
falsedontcropimage false kenablegridlazyload7
mediamax-width 750px crp-popup-fixed-theme-lightlg-outer7
lg-outer lg-pager-outer top7
lg-pager-outer top 64pximportant7
top 64pximportant bottom7
64pximportant bottom autoimportant7
bottom autoimportant mediamax-width7
autoimportant mediamax-width 750px7
750px crp-popup-fixed-theme-lightlg-outer lg-close7
b3b3b3 color ffffff7
crp-popup-fixed-theme-lightlg-outer lg-close margin7
color b3b3b3 width7
b3b3b3 width 45px7
padding-top 10pximportant crp-popup-fixed-theme-darklg-outer7
10pximportant crp-popup-fixed-theme-darklg-outer lg-close7
crp-popup-fixed-theme-darklg-outer lg-close margin7
10lazy falsedontcropimage false7
false kenablegridlazyload 07
overflow-y scroll lg-outer7
falsecounter falseenableswipe falseenabledrag7
470pxzoom falsedownload falsefullscreen7
falsedownload falsefullscreen falseautoplaycontrols7
falsefullscreen falseautoplaycontrols falsepager7
falseautoplaycontrols falsepager falsethumbnail7
falsepager falsethumbnail falsecounter7
falsethumbnail falsecounter falseenableswipe7
falseenableswipe falseenabledrag falseshare7
crp-popup-fixed-theme-darkwidth 700pxheight 470pxzoom7
falseenabledrag falseshare falsebackdropduration7
falseshare falsebackdropduration 10hidebarsdelay7
falsebackdropduration 10hidebarsdelay 1000007
global function init7
function init function7
init function id7
700pxheight 470pxzoom falsedownload7
falsemode lg-fadeaddclass fixed-size-frame7
kenablegridlazyload 0 kdirectlinking7
0 kviewerbackdropclass crp-3-popup-backdrop7
0 kdirectlinking 17
kdirectlinking 1 kloadurlblank7
1 kloadurlblank 17
kloadurlblank 1 kdisablealbumstylepresentation7
1 kdisablealbumstylepresentation 07
kdisablealbumstylepresentation 0 kviewerbackdropclass7
kviewerbackdropclass crp-3-popup-backdrop albumviewertypeisgrid7
trueactualsize falsemode lg-fadeaddclass7
crp-3-popup-backdrop albumviewertypeisgrid 07
albumviewertypeisgrid 0 hash7
0 hash falseautoplayfirstvideo7
hash falseautoplayfirstvideo truevideojs7
falseautoplayfirstvideo truevideojs truecontrols7
truevideojs truecontrols trueactualsize7
truecontrols trueactualsize falsemode7
scroll lg-outer lg-pager-outer7
250px overflow-y scroll7
lg-thumb-itemactive border 1px7
1important fixed-size-framelg-outer lg-close7
07important lg-backdropcrp-2-popup-backdrop opacity7
lg-backdropcrp-2-popup-backdrop opacity 085important7
opacity 085important lg-backdropcrp-1-popup-backdrop7
085important lg-backdropcrp-1-popup-backdrop opacity7
lg-backdropcrp-1-popup-backdrop opacity 1important7
opacity 1important fixed-size-framelg-outer7
fixed-size-framelg-outer lg-close margin7
lg-backdropcrp-3-popup-backdrop opacity 07important7
lg-close margin -20px7
margin -20px -20px7
-20px -20px 07
-20px 0 07
0 important width7
crp-popup-full-theme-lightlg-outer lg-actions lg-nexthover7
opacity 07important lg-backdropcrp-2-popup-backdrop7
important lg-backdropcrp-3-popup-backdrop opacity7
40px height 40px7
0 0 8px7
1px solid a90707important7
solid a90707important fixed-size-framelg-outer7
a90707important fixed-size-framelg-outer lg-img-wrap7
fixed-size-framelg-outer lg-img-wrap padding7
lg-img-wrap padding 07
padding 0 07
0 8px 0important7
pointer important lg-backdropcrp-3-popup-backdrop7
8px 0important lg-pager-thumb-cont7
0important lg-pager-thumb-cont display7
lg-pager-thumb-cont display noneimportant7
display noneimportant lg-thumb-item7
noneimportant lg-thumb-item cursor7
lg-thumb-item cursor pointer7
width 40px height7
height 40px padding-top7
max-height 250px overflow-y7
fixed-size-framelg-outer lg-inner overflow7
color cbcbcb fixed-size-framelg-outer7
cbcbcb fixed-size-framelg-outer lg7
fixed-size-framelg-outer lg overflow7
lg overflow visibleimportant7
overflow visibleimportant fixed-size-framelg-outer7
visibleimportant fixed-size-framelg-outer lg-inner7
lg-inner overflow hiddenimportant7
solid 000000 color7
overflow hiddenimportant crp-popup-thumbs-gridlg-outer7
hiddenimportant crp-popup-thumbs-gridlg-outer lg-thumb7
crp-popup-thumbs-gridlg-outer lg-thumb padding7
lg-thumb padding 10pximportant7
padding 10pximportant max-height7
10pximportant max-height 250px7
000000 color cbcbcb7
1px solid 0000007
40px padding-top 5pximportant7
255 255 border7
padding-top 5pximportant crp-popup-fixed-theme-lightlg-outer7
5pximportant crp-popup-fixed-theme-lightlg-outer lg-close7
crp-popup-fixed-theme-lightlg-outer lg-close background-color7
lg-close background-color rgb2557
background-color rgb255 2557
rgb255 255 2557
255 border 1px7
0 07 border7
color b3b3b3 crp-popup-fixed-theme-darklg-outer7
b3b3b3 crp-popup-fixed-theme-darklg-outer lg-close7
crp-popup-fixed-theme-darklg-outer lg-close background-color7
lg-close background-color rgba07
background-color rgba0 07
rgba0 0 07
0 0 077
lg-actions lg-nexthover crp-popup-full-theme-lightlg-outer7
crp-popup-full-theme-lightlg-outer lg-sub-html background-color7
lg-prevhover crp-popup-full-theme-lightlg-outer lg-actions7
crp-tile-inner overlayr background-color7
crp-tile crp-tile-inner ic-linkafter7
ic-search i color7
rgba2552552550733333333333 important color7
background-color rgba2552552550733333333333 important7
lg-actions lg-prevhover crp-popup-full-theme-lightlg-outer7
crp-tile-inner ic-search background-color7
link zoom icons7
cusomize link zoom7
important cusomize link7
rgba2552552550901960784314 important cusomize7
details background-color rgba25525525509019607843147
crp-tile-innercrp-details-bg details background-color7
crp-tile crp-tile-innercrp-details-bg details7
overlayr background-color rgba25525525509019607843147
crp-tile crp-tile-inner overlayr7
crp-tile crp-tile-inner ic-linkbefore7
- tile hover7
inputtypetext background-image urldataimagesvgxmlutf87
crp-catalog-widget-item inputtypetexthover background-image7
inputtypetexthover background-image urldataimagesvgxmlutf87
background-image urldataimagesvgxmlutf8 -7
urldataimagesvgxmlutf8 - -7
- - tile7
tile hover customizations7
crp-tile crp-tile-inner overlayl7
hover customizations customize7
customizations customize overlay7
customize overlay background7
crp-tile crp-tile-inner overlay7
crp-tile crp-tile-inner overlayt7
crp-tile crp-tile-inner overlayb7
crp-tile crp-tile-inner ic-searchafter7
crp-tile crp-tile-inner ic-searchbefore7
selecthover background-image urldataimagesvgxmlutf87
crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-link margin-left7
ic-linkic-fb-link margin-left -45px7
crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link margin-left7
crp-tilehover crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link7
crp-tile crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link7
crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-linkic-ln-link margin-left7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-linkic-ln-link7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-linkic-ln-link7
crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-link margin-left7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-link7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-link7
ic-linkic-fb-link margin-left 5px7
crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-linkic-fb-link margin-left7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-linkic-fb-link7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-linkic-fb-link7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-link7
crp-tile-inner ic-searchbefore background-color7
font-weight normal remove7
ic-searchbefore background-color rgba25525525517
background-color rgba2552552551 important7
rgba2552552551 important color7
details h3 color7
h3 color 4242427
p color 4242427
normal remove link7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-link7
remove link icon7
crp-tilehover crp-tile-inner ic-search7
crp-tile-inner ic-search margin-left7
crp-tilehover crp-tile-inner ic-link7
crp-tile-inner ic-link margin-left7
ic-link margin-left -20px7
crp-catalog-widget-item inputtypetext background-image7
crp-catalog-widget-item selecthover background-image7
crp-tilehover crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link7
important margin-left auto7
ftg-pages abefore background-color7
ftg-pages a color7
color 5c9b30 important7
crp-smooth-loader i color7
solid 5c9b30 important7
2px solid 5c9b307
border-bottom 2px solid7
crpprogressloaded border-bottom 2px7
crppreloader crpprogressloaded border-bottom7
ftg-pages float right7
margin-right auto important7
important margin-right auto7
auto important margin-right7
margin-left auto important7
100 important margin-left7
ftg-pages aselectedbefore background-color7
margin-right 0px important7
configuration goes here7
divnotcrp-catalog-widget crp-catalog-widget-item margin-left7
crp-catalog-widget-item margin-left 0px7
margin-left 0px important7
0px important margin-right7
important margin-right 0px7
0px important padding-left7
width 100 important7
important padding-left 0px7
padding-left 0px important7
0px important padding-right7
important padding-right 0px7
padding-right 0px important7
crp-wrapper width 1007
ftg-pages aselected color7
ftg-filters a color7
select background-image urldataimagesvgxmlutf87
inputtypetext color 969696important7
solid eeeimportant padding7
eeeimportant padding 15pximportant7
ui-dialog-title font-weight boldimportant7
ui-dialog-titlebar display noneimportant7
crp-catalog-widgetgkit-mobile-880 height 91pximportant7
crp-catalog-widget-item inputtypetext color7
color 969696important border-color7
border-bottom 1px solid7
969696important border-color 969696important7
crp-catalog-widget-item inputtypetexthover color7
inputtypetexthover color 1e73beimportant7
color 1e73beimportant border-color7
1e73beimportant border-color 1e73beimportant7
crp-catalog-widget-item select background-image7
1px solid eeeimportant7
ui-dialog-titlebar border-bottom 1px7
ftg-filters abefore background-color7
right background none7
ftg-filters aselected color7
ftg-filters aselectedbefore background-color7
crp-tilehover cursor pointer7
ui-dialog-titlebar ui-dialog-titlebar-close float7
ui-dialog-titlebar-close float right7
float right background7
background none font-size7
none border none7
none font-size 18px7
font-size 18px padding7
18px padding 04em7
padding 04em outline7
04em outline none7
outline none border7
crp-tile crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link7
ic-search background-color rgba25525525507333333333337
crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link margin-left7
255 07 border7
crp-popup-fixed-theme-lightlg-outer lg-inner border7
lg-inner border 1px7
b3b3b3 crp-popup-full-theme-lightlg-outer lg-toolbar7
crp-popup-full-theme-lightlg-outer lg-toolbar background-color7
lg-toolbar background-color rgba2557
0px crp-popup-full-theme-lightlg-outer lg-actions7
b3b3b3 crp-popup-full-theme-lightlg-outer lg-toogle-thumb7
color fff crp-popup-fixed-theme-lightlg-outer7
crp-popup-full-theme-lightlg-outer lg-toogle-thumb crp-popup-full-theme-lightlg-outer7
lg-toogle-thumb crp-popup-full-theme-lightlg-outer lg-counter7
crp-popup-full-theme-lightlg-outer lg-counter crp-popup-full-theme-lightlg-outer7
lg-counter crp-popup-full-theme-lightlg-outer lg-toolbar7
crp-popup-full-theme-lightlg-outer lg-toolbar lg-icon7
lg-toolbar lg-icon crp-popup-full-theme-lightlg-outer7
fff crp-popup-fixed-theme-lightlg-outer lg-inner7
lg-icon color fff7
lg-next color grey7
lg-img-wrap padding 40px7
0 bottom autoimportant7
bottom autoimportant background7
autoimportant background transparentimportant7
background transparentimportant width7
transparentimportant width 507
lg-inner lg-img-wrap padding7
padding 40px 5px7
fixed-sizelg-outer lg-toolbar lg-icon7
40px 5px 10px7
5px 10px 5px7
10px 5px fixed-sizelg-outer7
5px fixed-sizelg-outer lg-toolbar7
fixed-sizelg-outer lg-toolbar background-color7
height 0 fixed-sizelg-outer7
0 fixed-sizelg-outer lg-toolbar7
lg-icon crp-popup-full-theme-lightlg-outer lg-actions7
color grey crp-popup-simple-theme-lightlg-outer7
lg-sub-html top 07
color 303030 crp-popup-simple-theme-lightlg-outer7
crp-popup-simple-theme-lightlg-outer lg-actions lg-prevhover7
lg-actions lg-prevhover crp-popup-simple-theme-lightlg-outer7
lg-prevhover crp-popup-simple-theme-lightlg-outer lg-actions7
crp-popup-simple-theme-lightlg-outer lg-actions lg-nexthover7
lg-actions lg-nexthover color7
lg-nexthover color 3030307
303030 crp-popup-simple-theme-lightlg-outer lg-sub-html7
lg-toolbar lg-closehover crp-popup-simple-theme-lightlg-outer7
crp-popup-simple-theme-lightlg-outer lg-sub-html crp-popup-full-theme-lightlg-outer7
lg-sub-html crp-popup-full-theme-lightlg-outer lg-toolbar7
crp-popup-full-theme-lightlg-outer lg-toolbar lg-iconhover7
lg-toolbar lg-iconhover crp-popup-full-theme-lightlg-outer7
lg-iconhover crp-popup-full-theme-lightlg-outer lg-actions7
crp-popup-full-theme-lightlg-outer lg-actions lg-prevhover7
lg-closehover crp-popup-simple-theme-lightlg-outer lg-actions7
crp-popup-simple-theme-lightlg-outer lg-toolbar lg-closehover7
grey crp-popup-simple-theme-lightlg-outer lg-actions7
gray border 1px7
crp-popup-simple-theme-lightlg-outer lg-actions lg-prev7
lg-actions lg-prev crp-popup-simple-theme-lightlg-outer7
lg-prev crp-popup-simple-theme-lightlg-outer lg-actions7
crp-popup-simple-theme-lightlg-outer lg-actions lg-next7
07 color gray7
color gray border7
1px solid gray7
gray crp-popup-simple-theme-lightlg-outer lg-toolbar7
solid gray crp-popup-simple-theme-lightlg-outer7
gray crp-popup-simple-theme-lightlg-outer lg-counter7
crp-popup-simple-theme-lightlg-outer lg-counter crp-popup-simple-theme-lightlg-outer7
lg-counter crp-popup-simple-theme-lightlg-outer lg-toolbar7
crp-popup-simple-theme-lightlg-outer lg-toolbar lg-icon7
lg-icon color gray7
color gray crp-popup-simple-theme-lightlg-outer7
top 0 bottom7
255 07 color7
margin 0 auto7
cboxoverlay z-index 99999997
auto bottom 07
top auto bottom7
left top auto7
text-align left top7
absolute text-align left7
text-align left important7
bodylg-on text-align left7
cropping bodylg-on text-align7
screen cropping bodylg-on7
fix screen cropping7
ic-link margin-left -70px7
9999999 fix screen7
z-index 9999999 fix7
margin-left -70px important7
0 fixed-size-framelg-outer lg-toolbar7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link7
colorbox cboxoverlay z-index7
important colorbox cboxoverlay7
-20px important colorbox7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link7
crp-tile-innercrp-fix-explore-icon-pos ic-search margin-left7
crp-tile crp-tile-innercrp-fix-explore-icon-pos ic-search7
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link margin-left7
ic-linkic-fb-link margin-left -20px7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link7
margin-left 30px important7
ic-linkic-ln-link margin-left 30px7
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link margin-left7
bottom 0 fixed-size-framelg-outer7
fixed-size-framelg-outer lg-toolbar background-color7
fixed-sizelg-outer lg-sub-html p7
text-align center margin7
absolute text-align center7
fixed-sizelg-outer lg-sub-html position7
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-link7
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-link7
noneimportant fixed-sizelg-outer lg-sub-html7
background-color noneimportant fixed-sizelg-outer7
lg-inner background-color noneimportant7
fixed-sizelg-outer lg-inner background-color7
none fixed-sizelg-outer lg-inner7
display none fixed-sizelg-outer7
p display none7
height 0 fixed-size-framelg-outer7
lg-sub-html p display7
center fixed-sizelg-outer lg-sub-html7
4px 0 background-color7
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-link margin-left7
0 fixed-size-framelg-outer lg-inner7
fixed-size-framelg-outer lg-inner padding7
text-align center fixed-sizelg-outer7
padding 4px 07
lg-inner padding 4px7
0 background-color rgba0000857
background-color rgba000085 fixed-sizelg-outer7
rgba000085 fixed-sizelg-outer lg-sub-html7
fixed-sizelg-outer lg-sub-html h47
lg-sub-html h4 text-align7
h4 text-align center7
center margin 07
038 alle infosbester5
color inheritimportant jquerywindowloadfunction5
p color inheritimportant5
h3 gallery-4 crp-tile5
details h3 gallery-45
function id settings5
ic-link gallery-5 crp-tilehover4
vergleich 038 wichtige4
ic-link gallery-6 crp-tilehover4
ic-link gallery-7 crp-tilehover4
ic-link gallery-9 crp-tilehover4
ic-link gallery-4 crp-tilehover4
038 wichtige infosbester4
ic-link gallery-8 crp-tilehover4
ic-link gallery-3 crp-tilehover4
urldataimagesvgxmlutf8 crp-content-9 crp-catalog-widget-item3
ic-linkic-fb-link gallery-9 crp-tilehover3
gallery-9 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
gallery-9 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
ic-linkic-ln-link gallery-9 crp-tilehover3
background-image urldataimagesvgxmlutf8 crp-content-93
gallery-8 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
5px important gallery-93
-45px important gallery-93
ob man sich3
important gallery-9 ftg-pages3
-20px important gallery-93
000000 gallery-9 crp-tile3
important gallery-7 ftg-pages3
color 000000 gallery-93
important gallery-3 ftg-pages3
gallery-8 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
ic-linkic-ln-link gallery-3 crp-tilehover3
background-image urldataimagesvgxmlutf8 crp-content-73
-20px important gallery-33
urldataimagesvgxmlutf8 crp-content-3 crp-catalog-widget-item3
gallery-3 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
background-image urldataimagesvgxmlutf8 crp-content-33
038 alle infosbestes3
color 000000 gallery-33
038 alle infosbeste3
000000 gallery-3 crp-tile3
gallery-3 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
gallery-7 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
urldataimagesvgxmlutf8 crp-content-7 crp-catalog-widget-item3
gallery-7 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
ic-linkic-ln-link gallery-7 crp-tilehover3
5px important gallery-73
ic-linkic-fb-link gallery-7 crp-tilehover3
-45px important gallery-73
-20px important gallery-73
000000 gallery-7 crp-tile3
color 000000 gallery-73
5px important gallery-83
ic-linkic-ln-link gallery-8 crp-tilehover3
ic-linkic-fb-link gallery-4 crp-tilehover3
ic-linkic-fb-link gallery-8 crp-tilehover3
-20px important gallery-53
000000 gallery-4 crp-tile3
-20px important gallery-43
gallery-5 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
gallery-5 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
ic-linkic-ln-link gallery-5 crp-tilehover3
5px important gallery-53
ic-linkic-fb-link gallery-5 crp-tilehover3
-45px important gallery-53
000000 gallery-5 crp-tile3
-45px important gallery-33
color 000000 gallery-53
-45px important gallery-43
ic-linkic-fb-link gallery-3 crp-tilehover3
urldataimagesvgxmlutf8 crp-content-5 crp-catalog-widget-item3
background-image urldataimagesvgxmlutf8 crp-content-53
important gallery-5 ftg-pages3
gallery-4 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
gallery-4 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
ic-linkic-ln-link gallery-4 crp-tilehover3
color 000000 gallery-43
important gallery-6 ftg-pages3
5px important gallery-43
gallery-6 crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
-20px important gallery-83
000000 gallery-8 crp-tile3
color 000000 gallery-83
important gallery-4 ftg-pages3
5px important gallery-33
urldataimagesvgxmlutf8 crp-content-8 crp-catalog-widget-item3
background-image urldataimagesvgxmlutf8 crp-content-83
important gallery-8 ftg-pages3
gallery-6 crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link3
ic-linkic-ln-link gallery-6 crp-tilehover3
background-image urldataimagesvgxmlutf8 crp-content-63
5px important gallery-63
ic-linkic-fb-link gallery-6 crp-tilehover3
-45px important gallery-63
-20px important gallery-63
000000 gallery-6 crp-tile3
color 000000 gallery-63
background-image urldataimagesvgxmlutf8 crp-content-43
urldataimagesvgxmlutf8 crp-content-4 crp-catalog-widget-item3
urldataimagesvgxmlutf8 crp-content-6 crp-catalog-widget-item3
-45px important gallery-83
crp-tile crp-tile-inner105
255 25563
1px solid63
border 1px56
background-color rgba25556
rgba255 25556
0px 0px56
15px 0px42
solid b3b3b342
255 0742
grey 0px42
0px 15px42
crp-popup-full-theme-lightlg-outer lg-actions42
- -42
gallery-4 crp-tile38
none important35
lg-actions lg-next35
lg-actions lg-prev35
0 035
lg-actions lg-prevhover28
0px important28
margin-left -20px28
text-align center28
crp-popup-fixed-theme-darklg-outer lg-actions28
background-image urldataimagesvgxmlutf828
gallery-3 crp-tile28
crp-popup-fixed-theme-lightlg-outer lg-actions28
crp-tile-inner ic-link28
gallery-8 crp-tile28
gallery-5 crp-tile28
lg-actions lg-nexthover28
gallery-7 crp-tile28
gallery-6 crp-tile28
ic-link margin-left28
gallery-9 crp-tile28
crp-tile-inner ic-search28
crp-popup-simple-theme-lightlg-outer lg-actions28
-20px important28
crp-tile details24
-45px important21
color 00000021
margin-left -45px21
5px important21
important color21
margin-left 5px21
ic-linkic-fb-link margin-left21
ic-linkic-ln-link margin-left21
box-shadow grey21
grey 2px21
2px 2px21
2px 20px21
20px 2px21
lg-toolbar lg-iconhover21
color 30303021
lg-next background-color21
-moz-box-shadow grey21
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link21
-webkit-box-shadow grey21
lg-toolbar lg-icon21
lg-close margin21
0 important21
b3b3b3 color21
fixed-sizelg-outer lg-sub-html21
lg-toolbar background-color21
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link21
crp-popup-full-theme-lightlg-outer lg-toolbar21
display none19
test vergleich18
vergleich 03818
2021 test18
important gallery-717
important gallery-617
important gallery-317
important gallery-517
important gallery-917
important gallery-417
important gallery-817
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-ln-link14
crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-link14
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-ln-link14
crp-tile-innercrp-has-custom-linkcrp-has-ln-link ic-linkic-ln-link14
969696 text-decoration14
0px 014
border-color 1e73be14
color 1e73be14
crp-tile crp-tile-innercrp-has-fb-linkcrp-has-ln-link14
crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link14
crp-tilehover crp-tile-innercrp-has-fb-linkcrp-has-ln-link14
crp-tile-innercrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link14
aselected color14
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-link14
ftg-pages aselected14
margin 0px14
1e73be border-color14
crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-link14
important background-color14
fixed-sizelg-outer lg-toolbar14
424242 text-align14
ftg-pages aselectedbefore14
center font-size14
font-size 30px14
30px line-height14
line-height 32px14
32px font-weight14
border 0px14
crp-tile-innercrp-has-custom-linkcrp-has-fb-link ic-linkic-fb-link14
0 border14
255 014
crp-tilehover crp-tile-inner14
ic-search margin-left14
ftg-pages aselectedafter14
crp-tile crp-tile-innercrp-has-custom-linkcrp-has-fb-link14
crp-tilehover crp-tile-innercrp-has-custom-linkcrp-has-fb-link14
color gray14
lg-next color14
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-fb-link14
5c9b30 important14
float right14
crp-popup-fixed-theme-darklg-outer lg-close14
color b3b3b314
07 -webkit-box-shadow14
lg-inner background-color14
lg-close background-color14
crp-popup-fixed-theme-lightlg-outer lg-close14
color 96969614
0px -moz-box-shadow14
b3b3b3 crp-popup-full-theme-lightlg-outer14
bottom autoimportant14
969696 border-color14
border-color 96969614
crp-popup-fixed-theme-lightlg-outer lg-inner14
lg-img-wrap padding14
text-decoration none14
lg-icon color14
abefore background-color14
0px box-shadow14
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link ic-linkic-ln-link14
position absolute14
color grey14
0px solid14
crp-popup-full-theme-lightlg-outer lg-toogle-thumb14
07 border14
text-align left14
cursor pointer14
lg-sub-html position14
absolute text-align14
fixed-size-framelg-outer lg-inner14
lg-prev crp-popup-full-theme-lightlg-outer14
auto important14
0 fixed-size-framelg-outer14
0px crp-popup-full-theme-lightlg-outer14
background-color 96969614
background-color transparent14
transparent height14
height 014
color 42424214
font-weight normal14
aselectedbefore background-color14
crp-catalog-widget-item inputtypetexthover14
display noneimportant14
color cbcbcb14
crp-catalog-widget-item select14
crp-catalog-widget-item inputtypetext14
lg-iconhover color14
crp-catalog-widget-item selecthover14
rgba2552552550901960784314 important14
background-color rgba255255255090196078431414
crp-popup-full-theme-lightlg-outer lg-thumb-outer14
important margin-right14
07 important14
038 alle14
lg-sub-html color14
lg-sub-html background-color14
ftg-filters aselected14
ftg-filters aselectedafter14
width 100px14
crp-close-btn width14
crp-popup-full-theme-lightlg-outer lg-sub-html14
height 45px14
color ffffff14
crp-popup-fixed-theme-lightlg-outer lg-sub-html14
crp-popup-simple-theme-lightlg-outer lg-toolbar14
ftg-filters aselectedbefore14
background-color fff14
lg-toogle-thumb background-color14
pointer important14
background-color 1e73be14
width 45px14
45px height14
gray crp-popup-simple-theme-lightlg-outer14
padding-top 10pximportant14
45px padding-top14
gallery-3 ftg-pages13
gallery-7 ftg-pages13
gallery-9 ftg-pages13
gallery-4 ftg-pages13
gallery-8 ftg-pages13
gallery-5 ftg-pages13
gallery-6 ftg-pages13
gallery-4 ftg-filters12
gallery-8 crp-tilehover12
gallery-7 crp-tilehover12
gallery-9 ftg-filters12
gallery-8 ftg-filters12
p color12
details p12
details h312
gallery-6 crp-tilehover12
gallery-5 ftg-filters12
gallery-3 ftg-filters12
gallery-9 crp-tilehover12
gallery-5 crp-tilehover12
gallery-4 crp-tilehover12
gallery-6 ftg-filters12
gallery-3 crp-tilehover12
gallery-7 ftg-filters12
crp-content-6 crp-catalog-widget-item8
crp-content-3 crp-catalog-widget-item8
crp-content-8 crp-catalog-widget-item8
crp-content-5 crp-catalog-widget-item8
color fff8
crp-content-7 crp-catalog-widget-item8
crp-content-4 crp-catalog-widget-item8
crp-content-9 crp-catalog-widget-item8
important box-shadow7
box-shadow none7
-moz-box-shadow none7
2px crp-popup-full-theme-lightlg-outer7
0 8px7
8px 0important7
important -moz-box-shadow7
-webkit-box-shadow none7
crp-full-popuplg-outer lg-toolbar7
background-color rgba000057
crp-popup-full-theme-darklg-outer lg-toogle-thumb7
085important lg-backdropcrp-1-popup-backdrop7
0important lg-pager-thumb-cont7
lg-backdropcrp-1-popup-backdrop opacity7
lg-pager-thumb-cont display7
rgba00005 crp-full-popuplg-outer7
padding 07
important text-decoration7
lg-thumb-outer lg-thumb-itemactive7
2px -moz-box-shadow7
lg-thumb-outer lg-thumb-item7
lg-thumb-item border7
solid 999important7
999important crp-popup-full-theme-lightlg-outer7
lg-thumb-item cursor7
important lg-backdropcrp-3-popup-backdrop7
lg-backdropcrp-3-popup-backdrop opacity7
global function7
opacity 07important7
lg-backdropcrp-2-popup-backdrop opacity7
opacity 085important7
function init7
2px box-shadow7
lg-thumb-itemactive border7
init function7
fff -webkit-box-shadow7
lg-thumb-outer background-color7
noneimportant lg-thumb-item7
solid a90707important7
crp-popup-full-theme-lightlg-outerlg-thumb-open lg-thumb-outer7
function id7
noneimportant crp-popup-full-theme-lightlg-outerlg-thumb-open7
a90707important fixed-size-framelg-outer7
fixed-size-framelg-outer lg-img-wrap7
text-decoration noneimportant7
07important lg-backdropcrp-2-popup-backdrop7
crp-popup-thumbs-gridlg-outer lg-thumb7
opacity 1important7
10lazy falsedontcropimage7
kdisablealbumstylepresentation 07
1 kdisablealbumstylepresentation7
kloadurlblank 17
1 kloadurlblank7
kdirectlinking 17
0 kdirectlinking7
kenablegridlazyload 07
false kenablegridlazyload7
falsedontcropimage false7
200gridcellsize 10lazy7
kviewerbackdropclass crp-3-popup-backdrop7
4mintilewidth 200gridcellsize7
falsemargin 4mintilewidth7
falsefreeaddblocks falsemargin7
falseaddblock2height falsefreeaddblocks7
250addblock1height falseaddblock2height7
250approxtileheight 250addblock1height7
3approxtilewidth 250approxtileheight7
layouttype 3approxtilewidth7
jquerydocumentreadyfunction gkitconfiguregrid7
var gkitpermalink7
0 kviewerbackdropclass7
crp-3-popup-backdrop albumviewertypeisgrid7
new array7
falsedownload falsefullscreen7
10hidebarsdelay 1000007
falsebackdropduration 10hidebarsdelay7
falseshare falsebackdropduration7
falseenabledrag falseshare7
falseenableswipe falseenabledrag7
falsecounter falseenableswipe7
falsethumbnail falsecounter7
falsepager falsethumbnail7
falseautoplaycontrols falsepager7
falsefullscreen falseautoplaycontrols7
470pxzoom falsedownload7
albumviewertypeisgrid 07
700pxheight 470pxzoom7
crp-popup-fixed-theme-darkwidth 700pxheight7
lg-fadeaddclass fixed-size-frame7
falsemode lg-fadeaddclass7
trueactualsize falsemode7
truecontrols trueactualsize7
truevideojs truecontrols7
falseautoplayfirstvideo truevideojs7
hash falseautoplayfirstvideo7
0 hash7
array var7
wp-adminadmin-ajaxphp var7
1important fixed-size-framelg-outer7
background-color rgb2557
fixed-size-framelg-outer lg7
cbcbcb fixed-size-framelg-outer7
000000 color7
solid 0000007
0 077
rgba0 07
background-color rgba07
b3b3b3 crp-popup-fixed-theme-darklg-outer7
255 border7
rgb255 2557
5pximportant crp-popup-fixed-theme-lightlg-outer7
overflow visibleimportant7
padding-top 5pximportant7
40px padding-top7
height 40px7
40px height7
width 40px7
important width7
-20px 07
-20px -20px7
margin -20px7
fixed-size-framelg-outer lg-close7
lg overflow7
visibleimportant fixed-size-framelg-outer7
gkitnoprivajaxurl wp-adminadmin-ajaxphp7
top 64pximportant7
var gkitnoprivajaxurl7
10pximportant var7
ffffff width7
10pximportant crp-popup-fixed-theme-darklg-outer7
b3b3b3 width7
border-bottom noneimportant7
750px crp-popup-fixed-theme-lightlg-outer7
mediamax-width 750px7
autoimportant mediamax-width7
64pximportant bottom7
lg-pager-outer top7
lg-inner overflow7
lg-outer lg-pager-outer7
scroll lg-outer7
overflow-y scroll7
250px overflow-y7
max-height 250px7
10pximportant max-height7
padding 10pximportant7
lg-thumb padding7
hiddenimportant crp-popup-thumbs-gridlg-outer7
overflow hiddenimportant7
noneimportant crp-popup-full-theme-darklg-outer7
lg-closehover crp-popup-simple-theme-lightlg-outer7
b3b3b3 border-bottom7
1e73beimportant border-color7
customizations customize7
hover customizations7
tile hover7
- tile7
urldataimagesvgxmlutf8 -7
inputtypetexthover background-image7
inputtypetext background-image7
selecthover background-image7
select background-image7
border-color 1e73beimportant7
color 1e73beimportant7
rgba25525525505 border7
inputtypetexthover color7
border-color 969696important7
969696important border-color7
color 969696important7
inputtypetext color7
height 91pximportant7
crp-catalog-widgetgkit-mobile-880 height7
ui-dialog-titlebar display7
font-weight boldimportant7
ui-dialog-title font-weight7
customize overlay7
crp-tile-inner overlay7
eeeimportant padding7
background-color rgba25525525507333333333337
normal remove7
h3 color7
rgba2552552551 important7
background-color rgba25525525517
ic-searchbefore background-color7
crp-tile-inner ic-searchbefore7
crp-tile-inner ic-linkbefore7
crp-tile-inner ic-searchafter7
crp-tile-inner ic-linkafter7
rgba2552552550733333333333 important7
ic-search background-color7
crp-tile-inner overlayt7
zoom icons7
link zoom7
cusomize link7
important cusomize7
details background-color7
crp-tile-innercrp-details-bg details7
crp-tile crp-tile-innercrp-details-bg7
overlayr background-color7
crp-tile-inner overlayr7
crp-tile-inner overlayl7
crp-tile-inner overlayb7
padding 15pximportant7
solid eeeimportant7
link icon7
crp-wrapper width7
2px solid7
border-bottom 2px7
crpprogressloaded border-bottom7
crppreloader crpprogressloaded7
ftg-pages float7
margin-right auto7
margin-left auto7
important margin-left7
100 important7
width 1007
padding-right 0px7
color 5c9b307
important padding-right7
padding-left 0px7
important padding-left7
margin-right 0px7
margin-left 0px7
crp-catalog-widget-item margin-left7
divnotcrp-catalog-widget crp-catalog-widget-item7
goes here7
configuration goes7
options configuration7
solid 5c9b307
ftg-pages aafter7
border-bottom 1px7
right background7
ui-dialog-titlebar border-bottom7
border none7
none border7
outline none7
04em outline7
padding 04em7
18px padding7
font-size 18px7
none font-size7
background none7
ui-dialog-titlebar-close float7
ftg-pages abefore7
ui-dialog-titlebar ui-dialog-titlebar-close7
z-index 200007
crp-tilehover cursor7
ftg-filters ahoverbefore7
ftg-filters ahoverafter7
ftg-filters ahover7
ftg-filters abefore7
ftg-filters aafter7
ftg-pages ahoverbefore7
ftg-pages ahoverafter7
ftg-pages ahover7
remove link7
overlay background7
lg-prev crp-popup-fixed-theme-lightlg-outer7
color 303030important7
portfolio options7
lg-toolbar lg-closehover7
margin 1px7
1px crp-popup-fixed-theme-lightlg-outer7
lg-counter crp-popup-simple-theme-lightlg-outer7
crp-popup-simple-theme-lightlg-outer lg-counter7
solid gray7
gray border7
07 color7
lg-prev crp-popup-simple-theme-lightlg-outer7
303030important crp-popup-fixed-theme-lightlg-outer7
ffffff crp-popup-fixed-theme-lightlg-outer7
grey crp-popup-simple-theme-lightlg-outer7
lg-icon crp-popup-full-theme-lightlg-outer7
lg-counter crp-popup-full-theme-lightlg-outer7
crp-popup-full-theme-lightlg-outer lg-counter7
303030 crp-popup-fixed-theme-lightlg-outer7
lg-inner border7
fff crp-popup-fixed-theme-lightlg-outer7
0 fixed-sizelg-outer7
5px fixed-sizelg-outer7
10px 5px7
important margin7
lg-prevhover crp-popup-simple-theme-lightlg-outer7
40px 5px7
lg-nexthover crp-popup-full-theme-lightlg-outer7
66 crp-popup-full-theme-lightlg-outer7
66 667
rgb66 667
color rgb667
grey crp-popup-fixed-theme-lightlg-outer7
lg-prevhover crp-popup-fixed-theme-lightlg-outer7
lg-toogle-thumbhover color7
crp-popup-full-theme-lightlg-outer lg-toogle-thumbhover7
lg-nexthover crp-popup-fixed-theme-lightlg-outer7
crp-popup-fixed-theme-lightlg-outer lg-toolbar7
303030 crp-popup-fixed-theme-darklg-outer7
lg-nexthover color7
lg-prev crp-popup-fixed-theme-darklg-outer7
lg-prevhover crp-popup-full-theme-lightlg-outer7
cbcbcb crp-popup-fixed-theme-darklg-outer7
lg-iconhover crp-popup-full-theme-lightlg-outer7
lg-sub-html crp-popup-full-theme-lightlg-outer7
lg-prevhover crp-popup-fixed-theme-darklg-outer7
lg-nexthover crp-popup-fixed-theme-darklg-outer7
crp-popup-fixed-theme-darklg-outer lg-toolbar7
crp-popup-simple-theme-lightlg-outer lg-sub-html7
303030 crp-popup-simple-theme-lightlg-outer7
5px 10px7
lg-toogle-thumb crp-popup-full-theme-lightlg-outer7
padding 40px7
fix screen7
padding 4px7
lg-inner padding7
fixed-size-framelg-outer lg-toolbar7
lg-inner lg-img-wrap7
auto bottom7
top auto7
left top7
left important7
bodylg-on text-align7
cropping bodylg-on7
screen cropping7
9999999 fix7
0 background-color7
z-index 99999997
background-color rgba255255255057
cboxoverlay z-index7
colorbox cboxoverlay7
important colorbox7
crp-tile-innercrp-fix-explore-icon-pos ic-search7
crp-tile crp-tile-innercrp-fix-explore-icon-pos7
30px important7
margin-left 30px7
-70px important7
margin-left -70px7
4px 07
bottom 07
background-color rgba0000857
noneimportant fixed-sizelg-outer7
background-color noneimportant7
rgba000085 fixed-sizelg-outer7
center margin7
fixed-sizelg-outer lg-inner7
none fixed-sizelg-outer7
margin 07
0 auto7
lg-sub-html top7
top 07
0 bottom7
p display7
lg-sub-html p7
autoimportant background7
center fixed-sizelg-outer7
background transparentimportant7
transparentimportant width7
h4 text-align7
width 507
lg-sub-html h47
fff crp-popup-full-theme-lightlg-outer7
ic-link gallery-85
ic-link gallery-95
id settings5
ic-link gallery-65
ic-link gallery-35
inheritimportant jquerywindowloadfunction5
color inheritimportant5
h3 gallery-45
ic-link gallery-55
ic-link gallery-75
ic-link gallery-45
alle infosbester5
aselectedafter gallery-74
sie eine4
wichtige infosbester4
038 wichtige4
aselectedafter gallery-94
1e73be gallery-94
1e73be gallery-74
1e73be gallery-54
aselectedafter gallery-54
1e73be gallery-34
aselectedafter gallery-84
1e73be gallery-84
1e73be gallery-64
1e73be gallery-44
aselectedafter gallery-44
aselectedafter gallery-64
aselectedafter gallery-34
ic-linkic-ln-link gallery-33
ic-linkic-ln-link gallery-43
ic-linkic-fb-link gallery-43
alle infosbeste3
ic-linkic-ln-link gallery-83
000000 gallery-43
alle infosbestes3
ic-linkic-ln-link gallery-73
keine cookies3
man sich3
ob man3
urldataimagesvgxmlutf8 crp-content-33
000000 gallery-33
urldataimagesvgxmlutf8 crp-content-43
000000 gallery-53
ic-linkic-fb-link gallery-73
000000 gallery-93
000000 gallery-83
urldataimagesvgxmlutf8 crp-content-83
ic-linkic-ln-link gallery-63
urldataimagesvgxmlutf8 crp-content-93
ic-linkic-fb-link gallery-63
000000 gallery-63
ic-linkic-fb-link gallery-93
000000 gallery-73
ic-linkic-ln-link gallery-93
urldataimagesvgxmlutf8 crp-content-63
ic-linkic-ln-link gallery-53
ic-linkic-fb-link gallery-53
urldataimagesvgxmlutf8 crp-content-73
ic-linkic-fb-link gallery-83
urldataimagesvgxmlutf8 crp-content-53
ic-linkic-fb-link gallery-33
important268
crp-tile206
color205
0px196
background-color184
0147
1126
lg-actions126
crp-tile-inner119
crp-popup-full-theme-lightlg-outer119
margin-left98
ftg-pages91
crp-tilehover84
ftg-filters84
solid84
gallery-478
border77
crp-popup-fixed-theme-lightlg-outer77
lg-toolbar77
grey77
none75
lg-sub-html70
ic-link70
1px70
2px70
gallery-568
gallery-968
gallery-668
gallery-368
gallery-868
gallery-768
crp-catalog-widget-item63
rgba25556
crp-popup-simple-theme-lightlg-outer56
b3b3b356
crp-popup-fixed-theme-darklg-outer49
width49
-49
0749
fixed-sizelg-outer42
height42
text-align42
fixed-size-framelg-outer42
-20px42
crp-tile-innercrp-has-custom-linkcrp-has-fb-linkcrp-has-ln-link42
ic-linkic-fb-link42
lg-inner42
padding42
ic-linkic-ln-link42
1e73be42
242
15px42
border-color42
lg-next35
lg-close35
lg-prev35
5px35
noneimportant35
margin35
ic-search35
display33
details31
var29
crp-tile-innercrp-has-fb-linkcrp-has-ln-link28
lg-nexthover28
center28
crp-tile-innercrp-has-custom-linkcrp-has-ln-link28
45px28
lg-prevhover28
crp-tile-innercrp-has-custom-linkcrp-has-fb-link28
urldataimagesvgxmlutf828
box-shadow28
-moz-box-shadow28
-webkit-box-shadow28
auto28
aselectedbefore28
aselectedafter28
background-image28
aselected28
00000028
background22
top22
fff22
opacity21
10pximportant21
20px21
lg-thumb-outer21
lg-icon21
30px21
-45px21
lg-iconhover21
321
40px21
lg-toogle-thumb21
bottom21
gray21
padding-top21
font-weight21
421
font-size21
text-decoration21
ui-dialog-titlebar21
border-bottom21
test21
03820
p19
vergleich19
alle16
function15
ahover14
z-index14
pointer14
cursor14
inputtypetexthover14
absolute14
position14
left14
ahoverbefore14
ahoverafter14
1e73beimportant14
autoimportant14
lg-img-wrap14
abefore14
aafter14
right14
float14
margin-right14
lg-counter14
514
cbcbcb14
ffffff14
lg-thumb-item14
overflow14
5c9b3014
transparent14
normal14
crp-close-btn14
selecthover14
overlay14
969696important14
inputtypetext14
rgba255255255090196078431414
link14
100px14
614
714
select14
32px14
line-height14
h312
sie10
crp-content-310
crp-content-410
crp-content-510
crp-content-610
crp-content-810
crp-content-910
crp-content-710
infosbester9
die9
new8
eine8
oder8
jquerydocumentreadyfunction8
mit8
falsethumbnail7
falsecounter7
falsedontcropimage7
gkitnoprivajaxurl7
wp-adminadmin-ajaxphp7
lg-fadeaddclass7
falsemode7
fixed-size-frame7
750px7
crp-popup-fixed-theme-darkwidth7
global7
id7
lg7
false7
visibleimportant7
hiddenimportant7
crp-popup-thumbs-gridlg-outer7
init7
lg-thumb7
max-height7
700pxheight7
250px7
overflow-y7
scroll7
lg-outer7
470pxzoom7
cookies7
lg-pager-outer7
64pximportant7
mediamax-width7
trueactualsize7
falseenableswipe7
truecontrols7
falsepager7
falsebackdropduration7
kdirectlinking7
jquerywindowloadfunction7
87
10hidebarsdelay7
falseautoplaycontrols7
250approxtileheight7
kdisablealbumstylepresentation7
250addblock1height7
falseaddblock2height7
falsefreeaddblocks7
falsemargin7
4mintilewidth7
200gridcellsize7
kloadurlblank7
3approxtilewidth7
10lazy7
albumviewertypeisgrid7
truevideojs7
kenablegridlazyload7
der7
falseautoplayfirstvideo7
falseenabledrag7
rgba07
array7
layouttype7
falsedownload7
falsefullscreen7
gkitpermalink7
crp-3-popup-backdrop7
falseshare7
gkitconfiguregrid7
kviewerbackdropclass7
hash7
settings7
rgb2557
customize7
boldimportant7
crp-submit-btn7
crp-catalog-widgetgkit-mobile-8807
91pximportant7
tile7
hover7
customizations7
overlayt7
15pximportant7
overlayb7
overlayl7
overlayr7
crp-tile-innercrp-details-bg7
cusomize7
zoom7
icons7
rgba25525525507333333333337
ui-dialog-title7
eeeimportant7
ic-searchafter7
padding-right7
sich7
portfolio7
options7
configuration7
goes7
here7
divnotcrp-catalog-widget7
padding-left7
crp-wrapper7
outline7
97
crppreloader7
crpprogressloaded7
crp-smooth-loader7
107
ui-dialog-titlebar-close7
5pximportant7
04em7
ic-linkafter7
18px7
ic-linkbefore7
1important7
rgba255255255057
crp-popup-full-theme-darklg-outer7
rgba000057
crp-full-popuplg-outer7
crp-popup-full-theme-lightlg-outerlg-thumb-open7
999important7
lg-thumb-itemactive7
ic-searchbefore7
rgb667
a90707important7
8px7
0important7
lg-pager-thumb-cont7
lg-backdropcrp-3-popup-backdrop7
lg-backdropcrp-1-popup-backdrop7
085important7
07important7
303030important7
lg-backdropcrp-2-popup-backdrop7
lg-toogle-thumbhover7
4px7
rgba25525525517
remove7
icon7
-70px7
crp-tile-innercrp-fix-explore-icon-pos7
colorbox7
cboxoverlay7
117
fix7
screen7
cropping7
lg-closehover7
bodylg-on7
rgba0000857
10px7
127
transparentimportant7
h47
es6
fr6
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-45
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-95
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-85
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-65
badezimmer5
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-75
inheritimportant5
man5
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-55
ui-widget-contentaria-describedbycrp-product-enquiry-dialog-35
wohnzimmer5
wohnideen4
gartenmbel4
ui-widget-contentaria-describedbycrp-success-dialog-74
kinderzimmer4
auswahl4
wichtige4
ob4
134
ui-widget-contentaria-describedbycrp-success-dialog-94
ui-widget-contentaria-describedbycrp-success-dialog-84
ui-widget-contentaria-describedbycrp-success-dialog-64
im4
nicht4
ui-widget-contentaria-describedbycrp-success-dialog-34
ui-widget-contentaria-describedbycrp-success-dialog-44
ein4
ui-widget-contentaria-describedbycrp-success-dialog-54
von4
keine3
zulassen3
zu3
um3
cookie3
den3
einer3
infosbeste3
treffen3
entscheidet3
infosbestes3
nur3
mbel3
ist3
auch3
datenschutzerklrung3
impressum3
nbsp3
brombel3

Who hosts Wohn-welt.org?

Wohn-welt.org Hosting Provider Information

Hosted IP Address:85.13.153.32
Hosted Hostname:dd15500.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.0964
Location Longitude:14.6712
Webserver Software:Apache

Is "Neue Medien Muennich GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Neue Medien Muennich GmbH
0.1638%

HTTP Header Analysis for Wohn-welt.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 17 Sep 2021 15:41:54 GMT
Server: Apache
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Wohn-welt.org Domain Nameserver Information

HostIP AddressCountry
ns5.kasserver.com 85.13.128.3
ns6.kasserver.com 85.13.159.101


Need to find out who hosts Wohn-welt.org?


Domain Registration (WhoIs) information for Wohn-welt.org

 Domain Name: WOHN-WELT.ORG
Registry Domain ID: D402200000006518751-LROR
Registrar WHOIS Server: whois.registrygate.com
Registrar URL: http://www.registrygate.com
Updated Date: 2021-06-21T01:42:37Z
Creation Date: 2018-06-20T05:43:14Z
Registry Expiry Date: 2022-06-20T05:43:14Z
Registrar Registration Expiration Date:
Registrar: RegistryGate GmbH
Registrar IANA ID: 1328
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.1805734437
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Bantle Media GmbH
Registrant State/Province:
Registrant Country: DE
Name Server: NS5.KASSERVER.COM
Name Server: NS6.KASSERVER.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-09-17T15:40:56Z

Websites with Similar Names

Wohn-art-koeln.de
Startseite | Wohn Art Köln
Wohn-art24.de
Wohn-Art24 - Webshop Bernhard Klumpe e.K. • 49757 Werlte
Wohn-balance.com
Home | wohnbalance
Wohn-bau-magazin.de
wohn-bau-magazin.de – interessante Beiträge rund ums bauen und wohnen
Wohn-blogger.de
wohn-blogger - nachhaltiger low budget Wohn-Blog
Wohn-boerse-gap.de
Herzlich willkommen! - immobilien-trapps Webseite!
Wohn-deal.org
Immobilienmakler in Leipzig und Umgebung | WOHNDEALER
Wohn-dealer.org
Immobilienmakler in Leipzig und Umgebung | WOHNDEALER

Recently Updated Websites

Scientometrix.com (1 second ago.)Huohubet7943.com (1 second ago.)Insopra.com (4 seconds ago.)Maikir.xyz (4 seconds ago.)Infospot.net (6 seconds ago.)Tamu.us (6 seconds ago.)Historyofthemcu.com (9 seconds ago.)3horizonadvisors.com (11 seconds ago.)Computeforthecure.com (11 seconds ago.)Aoz-bergstrasse.de (13 seconds ago.)Hotelsykora.net (15 seconds ago.)Blue-chipadvicelettertonoticetoday.info (16 seconds ago.)Modestgreen.com (17 seconds ago.)Derickmorales.com (18 seconds ago.)Qiubet1099.com (18 seconds ago.)Peacelove-hope.com (19 seconds ago.)Genev.online (19 seconds ago.)Harmonygroup-ci.com (19 seconds ago.)Srimadhava.com (20 seconds ago.)Aubergeayerscliff.ca (21 seconds ago.)Etherly.org (21 seconds ago.)Moebel-rekla.net (22 seconds ago.)Balkanco.com (23 seconds ago.)Prospectamarketing.com (24 seconds ago.)Lugsto.com (25 seconds ago.)Afterhoursfmradio.com (25 seconds ago.)Jetfits.com (26 seconds ago.)Irradiationtherapie.com (26 seconds ago.)Hachettelivre.mx (28 seconds ago.)Fourartsclub.com (28 seconds ago.)

Recently Searched Keywords

2.sayfa m (1 second ago.)2019-09 (2 seconds ago.)groãŸer schweizer (3 seconds ago.)мадридский реал в примера дивизионе лидирует по количеству травм за сезон мадридский  (5 seconds ago.)model twingo (6 seconds ago.)creampie (6 seconds ago.)bodyn n (6 seconds ago.)georgia deer hunting season dates 2020 (8 seconds ago.)scrollbar (9 seconds ago.)itineraire velo ile de r (11 seconds ago.)people who trust us (11 seconds ago.)thp haircutters (11 seconds ago.)creampie (12 seconds ago.)renault megane (12 seconds ago.)nh cng b (14 seconds ago.)pc gtx 1650 ti (15 seconds ago.)meet the artist (16 seconds ago.)seenekleri (16 seconds ago.)baptisms (17 seconds ago.)vit-hn (18 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (18 seconds ago.)chairman’s message (20 seconds ago.)walking terra christa academy... (20 seconds ago.)lamelrondeller og lamelskiver til vinkelsliber (20 seconds ago.)taiff (21 seconds ago.)tablet toys (21 seconds ago.)praan (22 seconds ago.)relative comfort (22 seconds ago.)raquo yeganeh (22 seconds ago.)trustly (27 seconds ago.)