Worksafebc.com  |  WorkSafeBC.com - Home
Low trust score  | 
WorkSafeBC - the Workers' Compensation Board of BC - is dedicated to promoting workplace health and safety for the workers and employers of British Columbia.




Worksafebc.com Website Information

Website Ranks & Scores for Worksafebc.com

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:241,968
Majestic Rank Majestic Rank:37,222
Domain Authority Domain Authority:73%
DMOZ DMOZ Listing:Yes

Domain Information for Worksafebc.com

Domain Registrar: WEBNAMES.CA INC.
Registration Date:1999-04-08  1 decade 9 years 10 months ago
Last Modified:2015-03-27  3 years 10 months 2 weeks ago
Expiration Date:2017-04-08  1 year 10 months 1 week ago

Whois information for worksafebc.com

Full Whois Lookup for Worksafebc.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Worksafebc.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: WORKSAFEBC.COM
Registry Domain ID: 5428847_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.webnames.ca
Registrar URL: http://www.webnames.ca
Updated Date: 2017-08-10T15:01:29Z
Creation Date: 1999-04-08T04:00:00Z
Registry Expiry Date: 2022-04-08T04:00:00Z
Registrar: Webnames.ca Inc.
Registrar IANA ID: 456
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 18662217878
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.ELECTRIC.NET
Name Server: NS2.ELECTRIC.NET
Name Server: NS3.ELECTRIC.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-18T14:40:49Z

Who hosts Worksafebc.com?

Worksafebc.com is hosted by Savvis in California, Los Angeles, United States, 90001.
Worksafebc.com has an IP Address of 216.176.54.70 and a hostname of 216.176.54.70.



Worksafebc.com Web Server Information

Hosted IP Address:216.176.54.70
Hosted Hostname:216.176.54.70
Service Provider:Savvis
Hosted Country:United StatesUS
Location Latitude:34.0522
Location Longitude:-118.244
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Worksafebc.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 26 May 2015 11:10:03 GMT
Server: Microsoft-IIS/6.0
X-UA-Compatible: IE=EmulateIE7
X-Powered-By: ASP.NET
Content-Length: 40290
Content-Type: text/html
Cache-control: private


Need to find out who hosts Worksafebc.com?

Worksafebc.com Free SEO Report

Website Inpage Analysis for Worksafebc.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Worksafebc.com

contactamp relatedcoveoforsitecorecomponentsoptions analyticscustommetadata sitenamecoveoforsitecorecomponentsoptions analyticscustommetadataresources lawrehabilitation provideramp resources lawmorerelevancyrelevancy enableclientsideloggingsearchboxcoveoinitsearchbox ensearchnew coveosearchendpointresturi coveorestsitename website pagefullpathkeepomniboxsuggestionsprovidersdefaultordering false searchboxcoveoforsitecoreinitsearchboxid indexsourcename livepubinputattrplaceholder search worksafebccomflanguagefacetsitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2 sitenamedofilterresultsoncurrentculturetruefilterexpression not ftemplateid343adb6ca4f03ef4f47b9ac9ce2ba53ff97fe5dd82648c6436db87a7c4210c7413bwestnileviruslivepubcare provider vocationalus contact usus contactindexsourcename livepubif typeofdefaultsortfieldsearch worksafebccom sendtositecoreanalyticsclaim informationsitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusfalsesitecoreitemideventsworksafebccomworkerskeepomniboxsuggestionsprovidersdefaultorderingknow how muchreport a workplaceenglishcoveoforsitecorewebsite searchboxcoveoinitsearchbox ensearchpagename westnilevirussearchboxcoveoinitsearchbox ensearch searchboxcoveostatesafety committeeamp resourcesohs regulation ampfalse searchboxcoveoforsitecoreinitsearchbox coveoforsitecorecomponentsoptionssearchboxcoveostate flanguagefacet englishrestendpointuriboostexpressions clientlanguagefieldnamefalseispreviewinginpageeditor falseispreviewinginpageeditorwithsimulateddevicevocational rehabilitation providerrelevancy defaultsortcriterialowercase relevancysearchboxfindcoveosearchboxrestendpointuri coveorestamp servicessitename websitefalseexternalcollections externalsourcespolicy about usftemplateid343adb6ca4f03ef4f47b9ac9ce2ba53ff97fe5dd82648c6436db87a7c4210c7413b id97546a0c29c8488ca8d9eda04afde894 sitecoreitemuricoveorestv6analytics boostexpressions clientlanguagefieldnamemycostsfalsecoverage costsundefined coveoforsitecorecomponentsoptionssitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusanalyticsendpointurisitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirus pagenameinjurycare providerrelevancy defaultsortcriterialowercasedefaultsortcriterianospaceapply for coveragenew coveosearchendpointresturimemberquerystringargumentsviewpagefullpath sitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusanalyticsendpointuri coveorestv6analyticspagename westnilevirus restendpointuriforms ampworksafebcsitecoreitemuri sitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2searchboxcoveofunction varcoveosearchendpointendpointsdefault new coveosearchendpointresturiidensearch searchboxcoveostate flanguagefacetinsurancedefaultsorttype defaultsortfield defaultsortcriterianospacewebsite pagefullpath sitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusanalyticsendpointurifindsafe workplacebenefitsdefaultsortcriterialowercase relevancycoveoforsitecore undefined coveoforsitecorecomponentsoptions97546a0c29c8488ca8d9eda04afde894ftemplateid343adb6ca4f03ef4f47b9ac9ce2ba53ff97fe5dd82648c6436db87a7c4210c7413bsearchboxcoveoforsitecoreinitsearchbox coveoforsitecorecomponentsoptionsfz95xlatestversion343 pagefullpathfz95xlatestversion343sendtositecoreanalytics falsesitecoreitemidus logquerystringarguments sitecoreitemuri sitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2coveosearchendpointresturi coveorestlaw amp policyview claim informationreportsitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2 sitename websiteexternalsources filterresultsoncurrentcultureundefined coveoforsitecorecomponentsoptions analyticscustommetadatarequestensearch searchboxcoveostateiseditinginpageeditorreviewcoveosearchendpointendpointsdefaultensearch keepomniboxsuggestionsprovidersdefaultordering falseiseditinginpageeditor falseispreviewinginpageeditornews amp eventshealthnewsclearance letterwebsite searchredirectionurlhealth careif typeof coveoforsitecorefalsesitecoreitemid 97546a0c29c8488ca8d9eda04afde894searchredirectionurl ensearchformfilterresultsoncurrentculture truefilterexpression notsafetysitecoreitemuriexternalsourcesemployersearchboxplaceholdertextcoveosearchendpointendpointsdefault newuspagenamenot ftemplateid343adb6ca4f03ef4f47b9ac9ce2ba53ff97fe5dd82648c6436db87a7c4210c7413bfalsesitecoreitemid 97546a0c29c8488ca8d9eda04afde894 sitecoreitemurifalseexternalcollections externalsources filterresultsoncurrentcultureclientlanguagefieldname fz95xlanguage343 clientlanguagenamepagefullpath sitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirussearch worksafebccom0regulationtypeofsearchboxcoveostate flanguagefacetlearnensearchtopics how dofalseispreviewinginpageeditorvocational rehabilitationhealth amp safetyexternalsources filterresultsoncurrentculture truefilterexpressionnot ftemplateid343adb6ca4f03ef4f47b9ac9ce2ba53ff97fe5dd82648c6436db87a7c4210c7413b idsearchboxcoveoforsitecoreinitsearchbox coveoforsitecorecomponentsoptions elsefilterresultsoncurrentculture truefilterexpression97546a0c29c8488ca8d9eda04afde894 sitecoreitemuri sitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2create an accountpolicyrehabilitationenableclientsidelogging falseexternalcollections externalsourcesresourcescoveorest searchboxplaceholdertextsitecoreitemuri sitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2 sitenamefalseispreviewinginpageeditor falseispreviewinginpageeditorwithsimulateddevice falselatestversionfieldnamesitecorepub97546a0c29c8488ca8d9eda04afde894langenu0026ver2amp safety topicscoveoforsitecorecomponentsoptionskeepomniboxsuggestionsprovidersdefaultordering falseinformationcommitteeworkcoveorest searchboxplaceholdertext searchcoveorestv6analyticsresources law ampworkplaceworksafebccom sendtositecoreanalytics falsesitecoreitemidclientlanguagefieldnamenews ampfalseexternalcollectionsemployerssearchboxplaceholdertext search worksafebccomdefaultsorttypeinjury or diseasedo i reportclientlanguagename en defaultsorttypeproviderslivepub iseditinginpageeditor falseispreviewinginpageeditorclientlanguagefieldname fz95xlanguage343accountgetwebsite searchboxcoveoinitsearchboxwebsiteboostexpressions clientlanguagefieldname fz95xlanguage343truefilterexpression notclientlanguagenamehealth care providerregulation amp relatedservicestypeof coveoforsitecoreindexsourcenamecreateohsamtypeof coveoforsitecore undefinedcoveoforsitecorecomponentsoptions elselivepub iseditinginpageeditordefaultsortcriterianospace relevancyiseditinginpageeditor falseispreviewinginpageeditor falseispreviewinginpageeditorwithsimulateddevicetruefilterexpressionam a workerbusinesslogworksafebccom sendtositecoreanalyticsfalseispreviewinginpageeditorwithsimulateddevice falselatestversionfieldname fz95xlatestversion343falseispreviewinginpageeditorwithsimulateddevicesitename website searchredirectionurlquerystringarguments sitecoreitemuricommittee memberinputattrplaceholderanalyticscustommetadata sitenameanalyticscustommetadatarelatedsitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirus pagename westnilevirusflanguagefacet englishlog in createsendtositecoreanalyticsdefaultsorttype defaultsortfieldprovider vocational rehabilitationelseindustriessafety topicsftemplateid343adb6ca4f03ef4f47b9ac9ce2ba53ff97fe5dd82648c6436db87a7c4210c7413b id indexsourcenamesearch the ohsmuch coveragefalse searchboxcoveoforsitecoreinitsearchboxreadworkeramp safetycoveofunction var searchboxmanagelaw amptopicsknowcoveosearchendpointresturianalyticscustommetadata sitename websiteamp policyfalselatestversionfieldnamesitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusanalyticsendpointuri coveorestv6analyticsvocationalformswestnilevirus restendpointuriamp safety committeesearchsafety committee membernewcaresearchboxfindcoveosearchbox inputattrplaceholdermuchdecisionpagefullpath sitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirus pagenamerelevancy enableclientsidelogging falseexternalcollectionsenableclientsideloggingdiseaseamp related materialsvar searchboxindexsourcename livepub iseditinginpageeditorsendtositecoreanalytics falsesitecoreitemid 97546a0c29c8488ca8d9eda04afde894regulation ampprovider vocationalundefinedsearchboxplaceholdertext searchsearchboxcoveostatehealthysearchboxcoveoforsitecoreinitsearchboxhealth ampiflawmuch coverage costslettercontact us logpagefullpath sitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusanalyticsendpointuriapplyelse coveosearchendpointendpointsdefaultclaimsflanguagefacet english searchboxfindcoveosearchboxenglish searchboxfindcoveosearchbox inputattrplaceholdercontact uswebsite searchredirectionurl ensearchampdefaultsortcriterialowercaseohs regulationrestendpointuri coveorest searchboxplaceholdertextsearchredirectionurl ensearch keepomniboxsuggestionsprovidersdefaultorderingpagefullpathenableclientsidelogging falseexternalcollectionsnotcoveorestfalseispreviewinginpageeditorwithsimulateddevice falselatestversionfieldnameensearch keepomniboxsuggestionsprovidersdefaultorderingelse coveosearchendpointendpointsdefault newcoveoforsitecore undefinedcoveorest querystringargumentsfz95xlanguage343 clientlanguagenamesitenamedefaultsortfield defaultsortcriterianospace relevancysmallworker employersearchboxfindcoveosearchbox inputattrplaceholder searchrecoveryid indexsourcenameworkplace injuryhazardsfz95xlanguage343materialsdefaultsortcriterialowercase relevancy enableclientsideloggingcoveofunctionvarrelated materialscoveorestv6analytics boostexpressionsforms amp resourcesfalselatestversionfieldname fz95xlatestversion343amp eventsenglish searchboxfindcoveosearchboxdefaultsortfield defaultsortcriterianospaceget a clearancecoveorest querystringarguments sitecoreitemurisitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusanalyticsendpointuri coveorestv6analytics boostexpressionsinputattrplaceholder searchcoveoforsitecorecomponentsoptions else coveosearchendpointendpointsdefaultsearchredirectionurlview claimsafefalselatestversionfieldname fz95xlatestversion343 pagefullpathclearanceourwebsite pagefullpathsitename website searchboxcoveoinitsearchboxcoveosearchendpointresturi coveorest querystringargumentsrequest a reviewcoverageproviderclaimdefaultsortcriterianospace relevancy defaultsortcriterialowercasewestnilevirus restendpointuri coveorestsearchboxcoveoinitsearchboxfz95xlatestversion343 pagefullpath sitecorecontenthomehealthsafetyinjuriesdiseasesinfectiousdiseasestypeswestnilevirusmanage a healthyboostexpressions

Longtail Keyword Density for Worksafebc.com

KeywordsOccurences
health amp safety10
sitecoreitemuri sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver2 sitename6
report a workplace6
injury or disease6
sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver2 sitename website6
amp safety committee4
get a clearance4
request a review4
safety committee member4
vocational rehabilitation provider4
care provider vocational4
provider vocational rehabilitation4
health care provider4
coveosearchendpointendpointsdefault new coveosearchendpointresturi3
sitename website searchboxcoveoinitsearchbox3
website searchboxcoveoinitsearchbox ensearch3
else coveosearchendpointendpointsdefault new3
new coveosearchendpointresturi coveorest3
coveorest querystringarguments sitecoreitemuri3
coveoforsitecorecomponentsoptions else coveosearchendpointendpointsdefault3
coveosearchendpointresturi coveorest querystringarguments3
querystringarguments sitecoreitemuri sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver23
searchredirectionurl ensearch keepomniboxsuggestionsprovidersdefaultordering3
sitename website searchredirectionurl3
97546a0c-29c8-488c-a8d9-eda04afde894 sitecoreitemuri sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver23
falsesitecoreitemid 97546a0c-29c8-488c-a8d9-eda04afde894 sitecoreitemuri3
website searchredirectionurl ensearch3
searchboxcoveoinitsearchbox ensearch searchboxcoveostate3
false searchboxcoveoforsitecoreinitsearchbox coveoforsitecorecomponentsoptions3
keepomniboxsuggestionsprovidersdefaultordering false searchboxcoveoforsitecoreinitsearchbox3
ensearch keepomniboxsuggestionsprovidersdefaultordering false3
searchboxcoveoforsitecoreinitsearchbox coveoforsitecorecomponentsoptions else3
inputattrplaceholder search worksafebccom3
know how much3
amp related materials3
regulation amp related3
ohs regulation amp3
much coverage costs3
apply for coverage3
news amp events3
am a worker3
view claim information3
search the ohs3
do i report3
english searchboxfindcoveosearchbox inputattrplaceholder3
flanguage-facet english searchboxfindcoveosearchbox3
searchboxcoveostate flanguage-facet english3
searchboxfindcoveosearchbox inputattrplaceholder search3
sendtositecoreanalytics falsesitecoreitemid 97546a0c-29c8-488c-a8d9-eda04afde8943
topics how do3
manage a healthy3
amp safety topics3
ensearch searchboxcoveostate flanguage-facet3
worksafebccom sendtositecoreanalytics falsesitecoreitemid3
website pagefullpath sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virusanalyticsendpointuri3
pagefullpath sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virusanalyticsendpointuri coveorestv6analytics3
sitename website pagefullpath3
analyticscustommetadata sitename website3
coveoforsitecorecomponentsoptions analyticscustommetadata sitename3
sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virusanalyticsendpointuri coveorestv6analytics boostexpressions3
coveorestv6analytics boostexpressions clientlanguagefieldname3
defaultsorttype defaultsortfield defaultsortcriterianospace3
defaultsortfield defaultsortcriterianospace relevancy3
clientlanguagename en defaultsorttype3
clientlanguagefieldname fz95xlanguage343 clientlanguagename3
boostexpressions clientlanguagefieldname fz95xlanguage3433
undefined coveoforsitecorecomponentsoptions analyticscustommetadata3
coveoforsitecore undefined coveoforsitecorecomponentsoptions3
policy about us3
us contact us3
law amp policy3
resources law amp3
amp resources law3
contact us log3
log in create3
typeof coveoforsitecore undefined3
if typeof coveoforsitecore3
coveofunction var searchbox3
create an account3
defaultsortcriterianospace relevancy defaultsortcriterialowercase3
relevancy defaultsortcriterialowercase relevancy3
fz95xlatestversion343 pagefullpath sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virus3
pagefullpath sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virus pagename3
falselatestversionfieldname fz95xlatestversion343 pagefullpath3
falseispreviewinginpageeditorwithsimulateddevice falselatestversionfieldname fz95xlatestversion3433
falseispreviewinginpageeditor falseispreviewinginpageeditorwithsimulateddevice falselatestversionfieldname3
sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virus pagename west-nile-virus3
pagename west-nile-virus restendpointuri3
searchboxplaceholdertext search worksafebccom3
search worksafebccom sendtositecoreanalytics3
coveorest searchboxplaceholdertext search3
restendpointuri coveorest searchboxplaceholdertext3
west-nile-virus restendpointuri coveorest3
iseditinginpageeditor falseispreviewinginpageeditor falseispreviewinginpageeditorwithsimulateddevice3
livepub iseditinginpageeditor falseispreviewinginpageeditor3
falseexternalcollections externalsources filterresultsoncurrentculture3
externalsources filterresultsoncurrentculture truefilterexpression3
enableclientsidelogging falseexternalcollections externalsources3
relevancy enableclientsidelogging falseexternalcollections3
defaultsortcriterialowercase relevancy enableclientsidelogging3
filterresultsoncurrentculture truefilterexpression not3
truefilterexpression not ftemplateid343adb6ca4f-03ef-4f47-b9ac-9ce2ba53ff97fe5dd826-48c6-436d-b87a-7c4210c7413b3
indexsourcename livepub iseditinginpageeditor3
id indexsourcename livepub3
ftemplateid343adb6ca4f-03ef-4f47-b9ac-9ce2ba53ff97fe5dd826-48c6-436d-b87a-7c4210c7413b id indexsourcename3
not ftemplateid343adb6ca4f-03ef-4f47-b9ac-9ce2ba53ff97fe5dd826-48c6-436d-b87a-7c4210c7413b id3
forms amp resources3
health amp10
amp safety10
sitename website9
sitecoreitemuri sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver26
sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver2 sitename6
health care6
workplace injury6
search worksafebccom6
safety committee5
contact us5
committee member4
clearance letter4
care provider4
worker employer4
amp services4
if typeof4
provider vocational4
rehabilitation provider4
vocational rehabilitation4
coveorest querystringarguments3
coveosearchendpointresturi coveorest3
us contact3
website searchboxcoveoinitsearchbox3
searchboxcoveostate flanguage-facet3
ensearch searchboxcoveostate3
searchboxcoveoinitsearchbox ensearch3
new coveosearchendpointresturi3
querystringarguments sitecoreitemuri3
coveoforsitecorecomponentsoptions else3
ensearch keepomniboxsuggestionsprovidersdefaultordering3
website searchredirectionurl3
searchredirectionurl ensearch3
keepomniboxsuggestionsprovidersdefaultordering false3
flanguage-facet english3
else coveosearchendpointendpointsdefault3
searchboxcoveoforsitecoreinitsearchbox coveoforsitecorecomponentsoptions3
false searchboxcoveoforsitecoreinitsearchbox3
coveosearchendpointendpointsdefault new3
safety topics3
coverage costs3
much coverage3
related materials3
view claim3
claim information3
amp events3
news amp3
amp resources3
amp related3
regulation amp3
amp policy3
inputattrplaceholder search3
searchboxfindcoveosearchbox inputattrplaceholder3
law amp3
safe workplace3
ohs regulation3
resources law3
english searchboxfindcoveosearchbox3
97546a0c-29c8-488c-a8d9-eda04afde894 sitecoreitemuri3
defaultsortfield defaultsortcriterianospace3
defaultsorttype defaultsortfield3
fz95xlanguage343 clientlanguagename3
clientlanguagefieldname fz95xlanguage3433
defaultsortcriterianospace relevancy3
relevancy defaultsortcriterialowercase3
falseexternalcollections externalsources3
enableclientsidelogging falseexternalcollections3
relevancy enableclientsidelogging3
defaultsortcriterialowercase relevancy3
boostexpressions clientlanguagefieldname3
coveorestv6analytics boostexpressions3
undefined coveoforsitecorecomponentsoptions3
coveoforsitecore undefined3
typeof coveoforsitecore3
var searchbox3
coveoforsitecorecomponentsoptions analyticscustommetadata3
analyticscustommetadata sitename3
sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virusanalyticsendpointuri coveorestv6analytics3
pagefullpath sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virusanalyticsendpointuri3
website pagefullpath3
us log3
externalsources filterresultsoncurrentculture3
filterresultsoncurrentculture truefilterexpression3
restendpointuri coveorest3
west-nile-virus restendpointuri3
pagename west-nile-virus3
sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virus pagename3
coveorest searchboxplaceholdertext3
searchboxplaceholdertext search3
falsesitecoreitemid 97546a0c-29c8-488c-a8d9-eda04afde8943
sendtositecoreanalytics falsesitecoreitemid3
worksafebccom sendtositecoreanalytics3
forms amp3
pagefullpath sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virus3
fz95xlatestversion343 pagefullpath3
id indexsourcename3
ftemplateid343adb6ca4f-03ef-4f47-b9ac-9ce2ba53ff97fe5dd826-48c6-436d-b87a-7c4210c7413b id3
not ftemplateid343adb6ca4f-03ef-4f47-b9ac-9ce2ba53ff97fe5dd826-48c6-436d-b87a-7c4210c7413b3
truefilterexpression not3
indexsourcename livepub3
livepub iseditinginpageeditor3
falselatestversionfieldname fz95xlatestversion3433
falseispreviewinginpageeditorwithsimulateddevice falselatestversionfieldname3
falseispreviewinginpageeditor falseispreviewinginpageeditorwithsimulateddevice3
iseditinginpageeditor falseispreviewinginpageeditor3
coveofunction var3
amp41
health20
more16
safety15
us12
website11
workplace10
search9
sitename9
report9
provider9
coverage8
services8
resources8
manage7
care6
coveorest6
pagefullpath6
worksafebccom6
relevancy6
sitecoreitemuri6
claim6
committee6
injury6
ensearch6
disease6
sitecorepub97546a0c-29c8-488c-a8d9-eda04afde894langenu0026ver26
if6
create6
contact6
worksafebc6
coveoforsitecorecomponentsoptions6
topics5
account5
new5
policy5
law5
workers5
information5
view5
get5
do5
english5
clearance4
worker4
employer4
related4
typeof4
forms4
regulation4
request4
review4
decision4
member4
claims4
news4
letter4
small4
business4
am4
employers4
read4
vocational4
undefined4
rehabilitation4
form3
boostexpressions3
materials3
industries3
hazards3
clientlanguagename3
fz95xlanguage3433
clientlanguagefieldname3
learn3
ohs3
my3
sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virusanalyticsendpointuri3
coveorestv6analytics3
work3
coveoforsitecore3
our3
events3
03
recovery3
providers3
costs3
much3
apply3
find3
benefits3
safe3
know3
defaultsortfield3
west-nile-virus3
pagename3
sitecorecontenthomehealth-safetyinjuries-diseasesinfectious-diseasestypeswest-nile-virus3
fz95xlatestversion3433
restendpointuri3
enableclientsidelogging3
sendtositecoreanalytics3
var3
searchbox3
searchboxplaceholdertext3
falselatestversionfieldname3
falseispreviewinginpageeditorwithsimulateddevice3
not3
truefilterexpression3
filterresultsoncurrentculture3
externalsources3
ftemplateid343adb6ca4f-03ef-4f47-b9ac-9ce2ba53ff97fe5dd826-48c6-436d-b87a-7c4210c7413b3
id3
falseispreviewinginpageeditor3
iseditinginpageeditor3
livepub3
indexsourcename3
falsesitecoreitemid3
97546a0c-29c8-488c-a8d9-eda04afde8943
searchboxfindcoveosearchbox3
analyticscustommetadata3
flanguage-facet3
searchboxcoveostate3
inputattrplaceholder3
defaultsortcriterianospace3
defaultsorttype3
falseexternalcollections3
insurance3
log3
searchboxcoveoinitsearchbox3
querystringarguments3
keepomniboxsuggestionsprovidersdefaultordering3
searchredirectionurl3
defaultsortcriterialowercase3
coveofunction3
false3
searchboxcoveoforsitecoreinitsearchbox3
coveosearchendpointresturi3
coveosearchendpointendpointsdefault3
else3
healthy3

What are the nameservers for worksafebc.com?

Worksafebc.com Domain Nameserver Information

HostIP AddressCountry
ns1.electric.net 192.162.217.3Ireland Ireland
ns2.electric.net 72.35.23.2Canada Canada
ns3.electric.net 72.35.12.2Canada Canada

Worksafebc.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
worksafebc.comA291IP: 216.176.54.70
worksafebc.comNS86400Target: ns3.electric.net
worksafebc.comNS86400Target: ns2.electric.net
worksafebc.comNS86400Target: ns1.electric.net
worksafebc.comSOA300MNAME: ns1.electric.net
RNAME: dns.electric.net
Serial: 1308695403
Refresh: 10000
Retry: 1800
Expire: 604800
worksafebc.comMX3600Priority: 5
Target: worksafebc.com.mx1.electric.net
worksafebc.comMX3600Priority: 6
Target: worksafebc.com.mx2.electric.net
worksafebc.comTXT300TXT: v=spf1 ip4:216.254.154.101
ip4:207.112.15.224 ip4:207.112.15.225
ip4:207.112.15.229 ip4:64.114.100.248
ip4:64.114.100.249 ip4:64.114.100.250
ip4:207.34.170.250 ip4:207.34.170.251
ip4:207.34.170.252 ip4:64.40.99.134
ip4:142.34.141.9 ip4:142.34.141.8 ip4:20

Alexa Traffic Rank for Worksafebc.com


Alexa Search Engine Traffic for Worksafebc.com