worldlubesupply.net - Registered at Namecheap.com

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-04-14
Domain label
worldlubesupply
Domain extension
net
Domain registered:
2019-11-12
Domain updated:
2020-10-29
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Worldlubesupply.net registered?
A: Worldlubesupply.net was registered 1 year, 7 months, 6 days, 5 hours, 42 minutes, 16 seconds ago on Tuesday, November 12, 2019.
Q: When was the WHOIS for Worldlubesupply.net last updated?
A: The WHOIS entry was last updated 7 months, 2 weeks, 6 days, 5 hours, 42 minutes, 16 seconds ago on Thursday, October 29, 2020.
Q: What are Worldlubesupply.net's nameservers?
A: DNS for Worldlubesupply.net is provided by the following nameservers:
  • dns1.registrar-servers.com
  • dns2.registrar-servers.com
Q: Who is the registrar for the Worldlubesupply.net domain?
A: The domain has been registered at NAMECHEAP INC..
Q: What is the traffic rank for Worldlubesupply.net?
A: Worldlubesupply.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Worldlubesupply.net each day?
A: Worldlubesupply.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Worldlubesupply.net resolve to?
A: Worldlubesupply.net resolves to the IPv4 address 162.255.119.254.
Q: In what country are Worldlubesupply.net servers located in?
A: Worldlubesupply.net has servers located in the United States.
Q: What webserver software does Worldlubesupply.net use?
A: Worldlubesupply.net is powered by Namecheap-nginx webserver.
Q: Who hosts Worldlubesupply.net?
A: Worldlubesupply.net is hosted by NAMECHEAP-NET in United States.
Q: How much is Worldlubesupply.net worth?
A: Worldlubesupply.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Worldlubesupply.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Worldlubesupply.net Free SEO Report

Website Inpage Analysis for Worldlubesupply.net

H1 Headings

2 :
  1. worldlubesupply.net
  2. worldlubesupply.net

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Keyword Cloud for Worldlubesupply.net

constregistereddomainregistered at namecheapnamecheap

Longtail Keyword Density for Worldlubesupply.net

KeywordsOccurences
registered at namecheap4
domain5
const5
registered4
namecheap4

Who hosts Worldlubesupply.net?

Worldlubesupply.net Hosting Provider Information

Hosted IP Address:162.255.119.254
Hosted Hostname:162.255.119.254
Service Provider:NAMECHEAP-NET
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:namecheap-nginx

Is "NAMECHEAP-NET" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%

HTTP Header Analysis for Worldlubesupply.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 14 Apr 2021 23:01:05 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
Server: namecheap-nginx
Allow: GET, HEAD
Content-Encoding: gzip

Worldlubesupply.net Domain Nameserver Information

HostIP AddressCountry
dns1.registrar-servers.com 156.154.132.200
dns2.registrar-servers.com 156.154.133.200


Need to find out who hosts Worldlubesupply.net?


Domain Registration (WhoIs) information for Worldlubesupply.net

 Domain name: worldlubesupply.net
Registry Domain ID: 2454206783_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2020-10-29T15:55:43.30Z
Creation Date: 2019-11-12T14:08:53.00Z
Registrar Registration Expiration Date: 2021-11-12T14:08:53.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-04-14T13:01:09.44Z

Websites with Similar Names

World----series.com
Watch MLB World Series 2020 - Live, Start Time, TV Channel
World---series.com
World Series 2020 - LivE, sTreaM, ReDdiT, FrEE, Online, In HD
World--heritage.com
????????? – ???????????????
World--map.com
WORLD--MAP.COM
World-1-1.com
WORLD 1-1 Retro Arcade Game for iPhone
World-1.com
World-1.com is for sale - PerfectDomain.com
World-101.com
Squarespace - Website Expired

Recently Updated Websites

Fitaxis.net (5 seconds ago.)Naturallyorganix.com (5 seconds ago.)Dshs.state.tx.us (6 seconds ago.)Enterprise-protoyping.guru (7 seconds ago.)9680js07.com (7 seconds ago.)Tsoffice365.com (7 seconds ago.)Northernvirginiabeautysupply.com (8 seconds ago.)Earmark.info (8 seconds ago.)Fragilidade.net (8 seconds ago.)Aftermyart.net (9 seconds ago.)Screen.systems (9 seconds ago.)Disinfectingservices.org (9 seconds ago.)Huovip862.vip (10 seconds ago.)Appadesign.com (10 seconds ago.)Strandcollegehair.com (10 seconds ago.)Halkoz.hu (11 seconds ago.)Sribalajimedicals.com (13 seconds ago.)Olemartin.com (13 seconds ago.)Dekcsb.org (14 seconds ago.)Concrete5.org.pl (15 seconds ago.)Rrservice.info (16 seconds ago.)Bogomolov-lab.ru (16 seconds ago.)Hambak2025.org (17 seconds ago.)Animalhospitalnicholasville.com (17 seconds ago.)Medkhalilrachdi.com (18 seconds ago.)Taotaoav.com (18 seconds ago.)Confy-i.com (19 seconds ago.)Blindranger.com (20 seconds ago.)Masterlink.technology (20 seconds ago.)Newgotium.dk (20 seconds ago.)

Recently Searched Keywords

暗黑大天使 双线205服 | 玩游戏 (1 second ago.)vinaigrette cobb salad (2 seconds ago.)local guide program (2 seconds ago.)allianz (5 seconds ago.)karmay hedefliyoruz (9 seconds ago.)0 e6e6e6 (9 seconds ago.)elementtop (9 seconds ago.)muffler exhaust service (10 seconds ago.)dialog meminta dan memberikan pendapat (12 seconds ago.)könyvrendelés (15 seconds ago.)tkaniny pikowane (15 seconds ago.)930 pm (16 seconds ago.)persib (18 seconds ago.)best split keyboard for gaming (19 seconds ago.)sans-seriffont-size24pxelementor-198 (21 seconds ago.)based ministry committed (23 seconds ago.)friends of peterbrook school (24 seconds ago.)e6e6e6 100 (26 seconds ago.)rachel hamilton instagram (27 seconds ago.)gaoxinbpo (28 seconds ago.)k 124 days (29 seconds ago.)jt-631 (30 seconds ago.)szukać oszczędności po angielsku (31 seconds ago.)makki tv (36 seconds ago.)zoetis (36 seconds ago.)aramaic (37 seconds ago.)nobel_prize_medal.svg (37 seconds ago.)rateshrefmortgage-ratessublinksnameschoolshrefhttpwwwgreatschoolsnettargetblanksublinksnamerelocationhrefhttpwwwmovingcomtargetblanksublinksnameweatherhrefhttpwwwweathercomtargetblanksublinksnamereal (42 seconds ago.)condos (43 seconds ago.)100 dd321e (44 seconds ago.)