한국경제TV - 대한민국 대표 경제방송

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 33,894
Estimated Worth: $448,560

보는재미 버는기쁨 대한민국 대표 경제방송 한국경제TV



Domain summary

Last updated
2021-08-10
Domain label
wowtv
Domain extension
co.kr
Global Traffic Rank
33,894
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$448,560
Estimated daily income
$623
Estimated monthly income
$18,950

Frequently Asked Questions (FAQ)

Q: When was Wowtv.co.kr registered?
A: Wowtv.co.kr was registered 3 months, 3 weeks, 2 days, 3 hours, 27 minutes, 28 seconds ago on Tuesday, August 10, 2021.
Q: When was the WHOIS for Wowtv.co.kr last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 2 days, 3 hours, 27 minutes, 28 seconds ago on Tuesday, August 10, 2021.
Q: What are Wowtv.co.kr's nameservers?
A: DNS for Wowtv.co.kr is provided by the following nameservers:
  • article2.wowtv.co.kr
Q: Who is the registrar for the Wowtv.co.kr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Wowtv.co.kr?
A: Wowtv.co.kr ranks 33,894 globally on Alexa. Wowtv.co.kr has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Wowtv.co.kr each day?
A: Wowtv.co.kr receives approximately 51,927 visitors and 311,562 page impressions per day.
Q: What IP address does Wowtv.co.kr resolve to?
A: Wowtv.co.kr resolves to the IPv4 address 183.111.178.20.
Q: In what country are Wowtv.co.kr servers located in?
A: Wowtv.co.kr has servers located in the South Korea.
Q: What webserver software does Wowtv.co.kr use?
A: Wowtv.co.kr is powered by webserver.
Q: Who hosts Wowtv.co.kr?
A: Wowtv.co.kr is hosted by Korea Telecom in South Korea.
Q: How much is Wowtv.co.kr worth?
A: Wowtv.co.kr has an estimated worth of $448,560. An average daily income of approximately $623, which is roughly $18,950 per month.

Wowtv.co.kr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wowtv.co.kr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wowtv.co.kr

H1 Headings

0 :

H2 Headings

10 :
  1. visual area
  2. 뉴스 썸
  3. 이시각 특징주
  4. TV광고 이미지
  5. 오늘의 공개방송 더 보기
  6. 베스트 수익률
  7. 베트남·글로벌비즈 데일리뉴스 더 보기
  8. HOT 클릭! 더 보기

H3 Headings

2 :
  1. 방송 스케줄 2021-08-11 (수)
  2. tab area

H4 Headings

3 :
  1. 마이핀
  2. 와우캐시
  3. 고객센터

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

47 :

Google Adsense

:
pub-9861807982123522

Google Analytics

:
UA-51494055-1

Links - Internal

115:

Links - Internal (nofollow)

0:

Links - Outbound

40:

Links - Outbound (nofollow)

0:

Keyword Cloud for Wowtv.co.kr

swfattributes1else livetvplayerplaycdn isplaycdnhidebuttonajax type getfooterextend wrapboxtype02dataissuccessisplaycdn truealert183ittvplayerstopvodelse livetvplayerplaycdnswfplayeraddbtnquotkvinanews4else if edatafalsetype getnonetrytvplayerswfcontainerframehtmltrue varvodurltype post urlreturn falsehidebutton true addbtnsuccesshidebutton truetruefunction trysetliveyoutubeurl kakaourl39 39kvinahotmenubtn hidebuttonplayernewmenubtn hidebutton truedatakakaoplayer datayoutubeplayerwidth heightdatamembergradefloatbreak casehot hotwmodenumboximgelsealert else ifcasetvplayerstopvod catchnbspnbspwmode transparentelse if datareturncodeboxstockdataurldatayoutubeplayeriscdnpostif datareturncodenbspnbspnbspnbsp nbspnbspwrapboxtype02datakvinareturntvplayerstopvod catch ekornamemembergradeareatvmsetliveyoutubeurltype postboximg divobjcont5boxtype01type02success functionbreakhotswfvariablessuccess function datacatch epost urlboxtype01type02 boximg divobjcontelse ifchgratedatayoutubeplayer datakakaoplayerlivetvplayeropencover falseheighttrue addbtnlivetvplayerplaycdn isplaycdn trueif edataentrychgtypedatakakaoplayerlivetvplayerplaycdnfunction datagetajax type postfooterextendidplayermenubtnfunction varnulldatareturncodetvplayerswfcontainercssdisplaysnsdocumentreadyfunctionif dataissuccesseedata40pxifajaxtype2title02addmorefunctionupdownlivetvplayerplaycdn isplaycdnvarlivetvplayeropencoverisplaycdnnbspnbspnbspnbspwidthcatchkakaourltvplayerswfcontainercovercssdisplaytransparentalert elsedivdivobjconturlajax type0339 39 39swfparametersboxtype01type02 boximg

Longtail Keyword Density for Wowtv.co.kr

KeywordsOccurences
success function data7
else if datareturncode6
else livetvplayerplaycdn isplaycdn4
livetvplayerplaycdn isplaycdn true4
alert else if4
ajax type post3
type post url3
39 39 393
tvplayerstopvod catch e3
ajax type get3
menubtn hidebutton true3
hidebutton true addbtn3
else if edata3
box-type01type02 box-img divobj-cont3
hidebutton true12
else if11
function data7
success function7
ajax type6
if datareturncode6
alert else5
nbspnbspnbspnbsp nbspnbsp5
catch e5
datayoutubeplayer datakakaoplayer4
if edata4
isplaycdn true4
else livetvplayerplaycdn4
datakakaoplayer datayoutubeplayer4
livetvplayerplaycdn isplaycdn4
if dataissuccess4
post url4
39 394
return false3
break case3
footer-extend wrapbox-type023
box-img divobj-cont3
box-type01type02 box-img3
true var3
type post3
function try3
true addbtn3
setliveyoutubeurl kakaourl3
menubtn hidebutton3
tvplayerstopvod catch3
function var3
width height3
wmode transparent3
livetvplayeropencover false3
type get3
hot hot3
function39
var38
true34
if34
else21
false14
hidebutton13
data12
tv12
hot11
width11
height10
alert8
08
url7
success7
type7
num7
e7
ajax7
null7
datakakaoplayer6
16
none6
datareturncode6
footer-extend6
case6
isplaycdn6
kvina6
datayoutubeplayer6
membergrade5
try5
quot5
nbspnbspnbspnbsp5
return5
livetvplayeropencover5
catch5
25
kakaourl5
35
nbspnbsp5
post4
box-stock4
vodurl4
44
title02addmore4
swfattributes4
swfparameters4
swfvariables4
idplayer4
break4
kvinanews4
kvinahot4
iscdn4
edata4
float4
div4
livetvplayerplaycdn4
entrychgtype4
tvplayerstopvod4
dataissuccess4
dataurl3
wrapbox-type023
40px3
53
divobj-cont3
box-type01type023
box-img3
area3
transparent3
183it3
tvplayerswfcontainercovercssdisplay3
setliveyoutubeurl3
updown3
chgrate3
korname3
get3
tvplayerswfcontainercssdisplay3
sns3
documentreadyfunction3
datamembergrade3
swfplayer3
wmode3
tvplayerswfcontainerframehtml3
playernew3
menubtn3
addbtn3
m3

Who hosts Wowtv.co.kr?

Wowtv.co.kr Hosting Provider Information

Hosted IP Address:183.111.178.20
Hosted Hostname:183.111.178.20
Service Provider:Korea Telecom
Hosted Country:South KoreaKR
Location Latitude:37.5112
Location Longitude:126.9741
Webserver Software:Not Applicable

Is "Korea Telecom" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
Korea Telecom
0.1207%

HTTP Header Analysis for Wowtv.co.kr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html
Content-Encoding: gzip
Last-Modified: Tue, 10 Aug 2021 20:25:30 GMT
Accept-Ranges: bytes
ETag: "0d9cbdc258ed71:0"
Vary: Accept-Encoding
Access-Control-Allow-Origin: *
Date: Tue, 10 Aug 2021 20:30:33 GMT
Content-Length: 23691

Wowtv.co.kr Domain Nameserver Information

HostIP AddressCountry
article2.wowtv.co.kr 211.218.125.42South Korea South Korea


Need to find out who hosts Wowtv.co.kr?


Domain Registration (WhoIs) information for Wowtv.co.kr

 query : wowtv.co.kr

# KOREAN(UTF8)

도메인이름 : wowtv.co.kr
등록인 : (주)한국경제티브이
등록인 주소 : 영등포구 영등포동7가 제일빌딩
등록인 우편번호 : 150988
책임자 : (주)한국경제티브이
책임자 전자우편 : Login to show email
전화번호 : +82.0266760171
등록일 : 1999. 08. 07.
최근 정보 변경일 : 2013. 03. 08.
사용 종료일 : 2022. 08. 07.
정보공개여부 : Y
등록대행자 : (주)메일플러그(http://www.mailplug.com)
DNSSEC : 미서명

1차 네임서버 정보
호스트이름 : article2.wowtv.co.kr
IP 주소 : 211.218.125.42

2차 네임서버 정보
호스트이름 : dcsvr1.wowtv.co.kr
IP 주소 : 211.37.93.71

네임서버 이름이 .kr이 아닌 경우는 IP주소가 보이지 않습니다.

# ENGLISH

Domain Name : wowtv.co.kr
Registrant : hankyungwowtv
Registrant Address : Jeil Bldg. Yeongdeungpo-dong 7(chil)-ga, Yeongdeungpo-gu
Registrant Zip Code : 150988
Administrative Contact(AC) : hankyungwowtv
AC E-Mail : Login to show email
Phone Number : +82.0266760171
Registered Date : 1999. 08. 07.
Last Updated Date : 2013. 03. 08.
Expiration Date : 2022. 08. 07.
Publishes : Y
Authorized Agency : MAILPLUG Inc.(http://www.mailplug.com)
DNSSEC : unsigned

Primary Name Server
Host Name : article2.wowtv.co.kr
IP Address : 211.218.125.42

Secondary Name Server
Host Name : dcsvr1.wowtv.co.kr
IP Address : 211.37.93.71

- KISA/KRNIC WHOIS Service -

Websites with Similar Names

Wowtv.co
Coming Soon
Wowtv.co.kr
한국경제TV - 대한민국 대표 경제방송
Wowtv.com
WOWtv | Movies, Fashion and Entertainment.
Wowtv.net
wowtv.net -&nbspThis website is for sale! -&nbspwowtv Resources and Information.
Wowtv.org
WatchOutWeb Charities, INC | ORIGINAL PROGRAMS THAT BRIDGE COMMUNITIES
Wowtv.top
wowtv.top domain is for sale | Buy with Epik.com
Wowtv.tv
#1 Social Media Auto Poster and Scheduler - dlvr.it
Wowtv247.com
Click hot hot

Recently Updated Websites

Gotelltheworldinternationaloutreach.com (4 seconds ago.)Highpointrfs.com (9 seconds ago.)Proveedoresconfiables.info (11 seconds ago.)Mychairiot.com (14 seconds ago.)Astrology-insight.com (16 seconds ago.)Raocow.com (19 seconds ago.)Ibbick.com (22 seconds ago.)Notforgotten.love (22 seconds ago.)Motgagepayment.com (24 seconds ago.)Purimari.com (28 seconds ago.)Selleradviser.com (31 seconds ago.)Kudzucannabis.com (34 seconds ago.)Bendwagon.com (41 seconds ago.)Waqibkej.org (41 seconds ago.)Corus-immobilienberatung.com (44 seconds ago.)Brandesing.com (44 seconds ago.)Raree.xyz (47 seconds ago.)Socialadikt.com (49 seconds ago.)Bernieburner.com (51 seconds ago.)Jjmakeupclub.com (53 seconds ago.)Mumcentral.com.au (54 seconds ago.)Villainslair.net (58 seconds ago.)Joli-repere.com (1 minute ago.)Skydivingisland.com (1 minute 3 seconds ago.)Rightbrasil.com.br (1 minute 3 seconds ago.)Wheeloffortunesecretsanta.com (1 minute 9 seconds ago.)Detinf.com (1 minute 11 seconds ago.)Natel154.ru (1 minute 11 seconds ago.)Darlenetidd.realtor (1 minute 15 seconds ago.)Childdisrupted.com (1 minute 16 seconds ago.)

Recently Searched Keywords

足球滚球app学生第四党支部举... (1 second ago.)avalon park (1 second ago.)iwaya sushi (1 second ago.)zapf creation (1 second ago.)fading (1 second ago.)lapor spt tahunan 2019 (2 seconds ago.)iway namibia (3 seconds ago.)fading kitten syndrome (3 seconds ago.)iway transport (3 seconds ago.)iway transport (4 seconds ago.)iway (4 seconds ago.)iwayama sushi (5 seconds ago.)iwayafrica (5 seconds ago.)fadeinimage (5 seconds ago.)fadeinimage (5 seconds ago.)fading meaning (6 seconds ago.)шестеро рецидивистов обокрали 84-летнюю пенсионерку из забайкалья (7 seconds ago.)изнасилование (7 seconds ago.)αξεσουάρ my first baby annabell® (7 seconds ago.)fading synonym (7 seconds ago.)прием (8 seconds ago.)fading away meaning (8 seconds ago.)северный чита (8 seconds ago.)соревнования (8 seconds ago.)северный чита (9 seconds ago.)губернатор (9 seconds ago.)fading away (9 seconds ago.)english indonesia (9 seconds ago.)самокат (9 seconds ago.)remote support (9 seconds ago.)