Wuerth.at Favicon Wuerth.at

Wuerth.at Website Thumbnail
Checking...
Startseite Würth Online-Shop
Low trust score
 | 
Add a review Change category Claim this site
Befestigungstechnik kaufen Alles für den Handwerker direkt vom Weltmarktführer WÜRTH kaufen. Über 60.000 zufriedene Kunden!


Domain summary

Domain label
wuerth
Domain extension
at
Global Traffic Rank
822,282
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is wuerth.at ranked relative to other sites:

Percentage of visits to wuerth.at from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wuerth.at registered?
A: Wuerth.at was registered 2 weeks, 5 days, 15 hours, 48 minutes, 40 seconds ago on Wednesday, September 9, 2020.
Q: When was the WHOIS for Wuerth.at last updated?
A: The WHOIS entry was last updated 2 weeks, 5 days, 15 hours, 48 minutes, 40 seconds ago on Wednesday, September 9, 2020.
Q: What are Wuerth.at's nameservers?
A: DNS for Wuerth.at is provided by the following nameservers:
  • dns2.a1.net
  • dns3.a1.net
  • dns1.a1.net
Q: Who is the registrar for the Wuerth.at domain?
A: The domain has been registered at NIC-AT.
Q: What is the traffic rank for Wuerth.at?
A: Wuerth.at ranks 822,282 globally on Alexa. Wuerth.at has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Wuerth.at each day?
A: Wuerth.at receives approximately 1,070 visitors and 2,140 page impressions per day.
Q: What IP address does Wuerth.at resolve to?
A: Wuerth.at resolves to the IPv4 address 62.153.196.56.
Q: In what country are Wuerth.at servers located in?
A: Wuerth.at has servers located in the Germany.
Q: What webserver software does Wuerth.at use?
A: Wuerth.at is powered by webserver.
Q: Who hosts Wuerth.at?
A: Wuerth.at is hosted by Deutsche Telekom AG in Baden-württemberg, Germany, 74523.
Q: How much is Wuerth.at worth?
A: Wuerth.at has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Who hosts Wuerth.at?

Wuerth.at Hosting Provider Information

Hosted IP Address:62.153.196.56
Hosted Hostname:www56.witglobal.net
Service Provider:Deutsche Telekom AG
Hosted Country:GermanyDE
Location Latitude:49.1113
Location Longitude:9.7391
Webserver Software:Not Applicable

Is "Deutsche Telekom AG" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Wuerth.at

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 09 Sep 2020 06:00:16 GMT
Cache-Control: no-cache,no-store,must-revalidate
Pragma: no-cache
Expires: Thu, 01 Dec 1994 16:00:00 GMT
EXT-CACHEEXPIRE: 1599948060
Accept-Ranges: bytes
Keep-Alive: timeout=5, max=86
Connection: close
Content-Type: text/html;charset=utf-8
Strict-Transport-Security: max-age=31536000
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 46520
X-UA-Compatible: IE=Edge,chrome=1

Wuerth.at Domain Nameserver Information

HostIP AddressCountry
dns2.a1.net 192.174.68.105
dns3.a1.net 176.97.158.105
dns1.a1.net 80.120.17.26


Need to find out who hosts Wuerth.at?


WhoIs information for Wuerth.at

 % Copyright (c)2020 by NIC.AT (1)
%
% Restricted rights.
%
% Except for agreed Internet operational purposes, no part of this
% information may be reproduced, stored in a retrieval system, or
% transmitted, in any form or by any means, electronic, mechanical,
% recording, or otherwise, without prior permission of NIC.AT on behalf
% of itself and/or the copyright holders. Any use of this material to
% target advertising or similar activities is explicitly forbidden and
% can be prosecuted.
%
% It is furthermore strictly forbidden to use the Whois-Database in such
% a way that jeopardizes or could jeopardize the stability of the
% technical systems of NIC.AT under any circumstances. In particular,
% this includes any misuse of the Whois-Database and any use of the
% Whois-Database which disturbs its operation.
%
% Should the user violate these points, NIC.AT reserves the right to
% deactivate the Whois-Database entirely or partly for the user.
% Moreover, the user shall be held liable for any and all damage
% arising from a violation of these points.

% Quota exceeded

Wuerth.at Free SEO Report

Website Inpage Analysis for Wuerth.at

H1 Headings

0 :

H2 Headings

11 :
  1. Ihre Angebote im September
  2. Beliebte Produktkategorien
  3. Top-Seller für Profi-Handwerker
  4. Die Würth Welt für Profi-Handwerker
  5. Neu in der ORSY® Welt: Der Werkstattwagen, der passt
  6. Online bestellen und im Würth Shop abholen
  7. Ihre persönliche Informationsdrehscheibe
  8. Nah. Näher. Würth!
  9. Haben Sie Fragen?
  10. Ihre Vorteile im Würth Online-Shop
  11. Ihr Würth in Ihrer Nähe.

H3 Headings

6 :
  1. Qualität von Würth
  2. Würth – bewährter Partner für drei Millionen Kunden weltweit
  3. Hochwertige Montage- und Befestigungslösungen für jede Branche
  4. Würth bietet kunden- und branchenorientierten Service
  5. Profis in der Praxis: Systemlösungen von Würth
  6. Karriere bei Würth

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

4 :

Total Images

44 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-17112204-9

Links - Internal

158:
  1. No text
    http://www.wuerth.at
  2. Warenkorb 0
    https://eshop.wuerth.at/is-bin/INTERSHOP.enfinity/WFS/3123-B1-Site/de_DE/-/EUR/ViewCurrentReq-UnregisterPageable
  3. Online-Shop
    https://eshop.wuerth.at/de/DE/EUR/
  4. Services & Lösungen
    https://www.wuerth.at/de/wuerth_at/services/anwendungen/anwendungen_1.php
  5. Anwendungen
    https://www.wuerth.at/de/wuerth_at/services/anwendungen/anwendungen_1.php
  6. Newsletter
    https://www.wuerth.at/de/wuerth_at/services/newsletter_1/newsletter.php
  7. C-Teile Management
    https://www.wuerth.at/de/orsy_2/lagermanagement/cteilemanagement.php
  8. Ordnung mit System
    https://www.wuerth.at/de/orsy_2/orsy_2.php
  9. eBusiness
    https://www.wuerth.at/de/wuerth_at/services/eprocurement/ebusiness.php
  10. Spezialisten
    https://www.wuerth.at/de/wuerth_at/services/spezialisten/spezialisten.php
  11. Baustellenlogistik
    https://www.wuerth.at/de/orsy_2/die_loesungen/bauloc_baustellenlogistik/bauloc.php
  12. Beschläge-Center
    https://www.wuerth.at/de/wuerth_at/services/beschlaege_1/beschlaege_2.php
  13. Würth Shops
    https://www.wuerth.at/de/wuerth_at/niederlassungen/kundenzentren_teaser.php
  14. Würth Shops A-Z
    https://www.wuerth.at/de/wuerth_at/niederlassungen/kundenzentren_a_z/kundenzentren_neu.php
  15. Würth Shop finden
    https://www.wuerth.at/de/wuerth_at/niederlassungen/kundenzentrumsfinder/niederlassungsfinder.php
  16. Neueröffnungen
    https://www.wuerth.at/de/wuerth_at/niederlassungen/neueroeffnungen/neueroeffnungen.php
  17. Würth Bonusheft
    https://www.wuerth.at/de/wuerth_at/niederlassungen/wuerth_bonusheft/wuerth_bonusheft_1.php
  18. Veranstaltungen
    https://www.wuerth.at/de/wuerth_at/niederlassungen/veranstaltungen/veranstaltungen_1.php
  19. Grenzenloses Einkaufen
    https://www.wuerth.at/de/wuerth_at/niederlassungen/grenzenloses_einkaufen/wuerth_bonusheft_3.php
  20. Stromtankstelle
    https://www.wuerth.at/de/wuerth_at/niederlassungen/stromtankstelle/stromtankstelle.php
  21. Warendepot
    https://www.wuerth.at/de/wuerth_at/niederlassungen/warendepot/warendepot_1.php
  22. Wir suchen neue Standorte
    https://www.wuerth.at/de/wuerth_at/niederlassungen/wir_suchen_neue_standorte/neuestandorte.php
  23. 3D Rundgang
    https://www.wuerth.at/de/wuerth_at/niederlassungen/3d_rundgang/neuestandorte_1.php
  24. Unternehmen
    https://www.wuerth.at/de/wuerth_at/company/das_unternehmen/wuerth_in_oesterreich.php
  25. Das Unternehmen
    https://www.wuerth.at/de/wuerth_at/company/das_unternehmen/wuerth_in_oesterreich.php
  26. Presse
    https://www.wuerth.at/de/wuerth_at/company/presse_2/presse.php
  27. Kunst und Kultur
    https://www.wuerth.at/de/wuerth_at/company/kunst_und_kultur/kunst_und_kultur_1.php
  28. Logistik-Erweiterung
    https://www.wuerth.at/de/wuerth_at/company/lagerzubau/lagerzubau_2.php
  29. Nachwuchsförderung
    https://www.wuerth.at/de/wuerth_at/company/world_skills/world_skills_1.php
  30. Karriere
    https://www.wuerth.at/de/wuerth_at/karriere_1/karriere_home.php
  31. Würth Welt
    https://www.wuerth.at/de/wuerth_at/karriere_1/wuerth_welt/wuerth_welt.php
  32. Würth für dich
    https://www.wuerth.at/de/wuerth_at/karriere_1/wuerth_fuer_dich/wuerth_fuer_dich_1.php
  33. Du für Würth
    https://www.wuerth.at/de/wuerth_at/karriere_1/du_fuer_wuerth/du_fuer_wuerth_1.php
  34. Unsere Stellenangebote
    https://peris.wuerth.at/engage/jobexchange/searchJobOffersQuick.do?j=myjobexchange
  35. Jetzt registrieren
    https://eshop.wuerth.at/is-bin/INTERSHOP.enfinity/WFS/3123-B1-Site/de_DE/-/EUR/ViewRegistration-Step1View
  36. „Jetzt registrieren“
    https://eshop.wuerth.at/is-bin/INTERSHOP.enfinity/WFS/3123-B1-Site/de_DE/-/EUR/ViewRegistration-Step1View
  37. „Jetzt Registrieren“
    https://eshop.wuerth.at/is-bin/INTERSHOP.enfinity/WFS/3123-B1-Site/de_DE/-/EUR/ViewRegistration-Step1View
  38. Produktkategorien
    https://eshop.wuerth.at/Produktkategorien/Produktkategorien/3123.cyid/3123.cgid/de/DE/EUR/
  39. DIN-Katalog
    https://eshop.wuerth.at/DIN-Katalog/DIN-Katalog/DIN.cyid/DIN.cgid/de/DE/EUR/
  40. ISO-Katalog
    https://eshop.wuerth.at/ISO-Katalog/ISO-Katalog/ISO.cyid/ISO.cgid/de/DE/EUR/
  41. Sonderangebote
    https://eshop.wuerth.at/Sonderangebote/Sonderangebote/Sonderangebote.cyid/Sonderangebote.cgid/de/DE/EUR/
  42. Arbeitsschutz
    https://eshop.wuerth.at/Produktkategorien/Arbeitsschutz/312305.cyid/3123.cgid/de/DE/EUR/
  43. Baubedarf
    https://eshop.wuerth.at/Produktkategorien/Baubedarf/312310.cyid/3123.cgid/de/DE/EUR/
  44. Beschläge
    https://eshop.wuerth.at/Produktkategorien/Beschlaege/312315.cyid/3123.cgid/de/DE/EUR/
  45. Betriebsausrüstung
    https://eshop.wuerth.at/Produktkategorien/Betriebsausruestung/312320.cyid/3123.cgid/de/DE/EUR/
  46. Bolzenschubtechnik
    https://eshop.wuerth.at/Produktkategorien/Bolzenschubtechnik/312340.cyid/3123.cgid/de/DE/EUR/
  47. Brandschutz
    https://eshop.wuerth.at/Produktkategorien/Brandschutz/312325.cyid/3123.cgid/de/DE/EUR/
  48. Chemisch-technische Produkte
    https://eshop.wuerth.at/Produktkategorien/Chemisch-technische-Produkte/312330.cyid/3123.cgid/de/DE/EUR/
  49. Dübeltechnik
    https://eshop.wuerth.at/Produktkategorien/Duebeltechnik/312345.cyid/3123.cgid/de/DE/EUR/
  50. Elektroinstallation
    https://eshop.wuerth.at/Produktkategorien/Elektroinstallation/312355.cyid/3123.cgid/de/DE/EUR/
  51. Fahrzeugeinrichtungen und Zubehör
    https://eshop.wuerth.at/Produktkategorien/Fahrzeugeinrichtungen-und-Zubehoer/312356.cyid/3123.cgid/de/DE/EUR/
  52. Handwerkzeuge
    https://eshop.wuerth.at/Produktkategorien/Handwerkzeuge/312360.cyid/3123.cgid/de/DE/EUR/
  53. KFZ-Teile
    https://eshop.wuerth.at/Produktkategorien/KFZ-Teile/312365.cyid/3123.cgid/de/DE/EUR/
  54. Landwirtschaftsprodukte
    https://eshop.wuerth.at/Produktkategorien/Landwirtschaftsprodukte/312385.cyid/3123.cgid/de/DE/EUR/
  55. Löten und Schweißen
    https://eshop.wuerth.at/Produktkategorien/Loeten-und-Schweissen/312370.cyid/3123.cgid/de/DE/EUR/
  56. Maschinen
    https://eshop.wuerth.at/Produktkategorien/Maschinen/312350.cyid/3123.cgid/de/DE/EUR/
  57. Materialbearbeitung
    https://eshop.wuerth.at/Produktkategorien/Materialbearbeitung/312375.cyid/3123.cgid/de/DE/EUR/
  58. Messtechnik
    https://eshop.wuerth.at/Produktkategorien/Messtechnik/312361.cyid/3123.cgid/de/DE/EUR/
  59. ORSY-System
    https://eshop.wuerth.at/Produktkategorien/ORSY-System/312322.cyid/3123.cgid/de/DE/EUR/
  60. Sanitär, Heizung, Klima
    https://eshop.wuerth.at/Produktkategorien/Sanitaer-Heizung-Klima/312380.cyid/3123.cgid/de/DE/EUR/
  61. Schläuche, Kupplungen, Schlauchschellen
    https://eshop.wuerth.at/Produktkategorien/Schlaeuche-Kupplungen-Schlauchschellen/312321.cyid/3123.cgid/de/DE/EUR/
  62. Technische Gummi- und Kunststoffprodukte
    https://eshop.wuerth.at/Produktkategorien/Technische-Gummi-und-Kunststoffprodukte/312367.cyid/3123.cgid/de/DE/EUR/
  63. Verbindungselemente
    https://eshop.wuerth.at/Produktkategorien/Verbindungselemente/312335.cyid/3123.cgid/de/DE/EUR/
  64. Verkehrs- und Baustellensicherheit
    https://eshop.wuerth.at/Produktkategorien/Verkehrs-und-Baustellensicherheit/312307.cyid/3123.cgid/de/DE/EUR/
  65. +++ Coronavirus (COVID-19) – Unsere Maßnahmen, Verfügbarkeit, Versorgung +++
    https://www.wuerth.at/covid19
  66. Weitere Informationen
    https://www.wuerth.at/covid19
  67. ' + '' + //image 2 '' + '' + '
    https://www.wuerth.at/de/wuerth_at/services/aktionen/herbstaktion.php
  68. ' + '' + //image 3 '' + '' + '
    https://eshop.wuerth.at/Top-3-Set-Kombo-Paket-18-V-ABS-AWS-ABH-18-COMPACT-M-CUBE-MA-AKKU-SET-M-CUBE-ABH-AWS-ABS-18COMP/5701419004.sku/de/DE/EUR/
  69. ' + '' + //image 4 '' + '' + '
    https://www.wuerth.at/de/wuerth_at/services/aktionen/superhelfer.php
  70. ' + '' + //image 5 '' + '' + '
    https://www.wuerth.at/de/wuerth_at/services/aktionen/sommerbonus.php
  71. No text
    https://eshop.wuerth.at/is-bin/INTERSHOP.enfinity/WFS/3123-B1-Site/de_DE/-/EUR/ViewRegistration-Step1View?CampaignName=registrieren
  72. No text
    https://eshop.wuerth.at/Kartuschenpresseset-Profi-KARTPIST-MAN-SET-TOP-310ML-DUESE-25TLG/5988000291.sku/de/DE/EUR/?CampaignName=kartuschenpresse_set
  73. No text
    https://eshop.wuerth.at/Winkelschleifer-EWS-17-125-EQ-Power-WNKLSHLF-EL-EWS-17-125-EQ-POWER-/57070612.sku/de/DE/EUR/?CampaignName=wschleifer_power
  74. No text
    https://eshop.wuerth.at/Stichsaege-STP-140-Exact-S-mit-Saegeblaettern-MA-EL-SET-STP140-EXACT-S-SAGEBLATT/0988999054.sku/de/DE/EUR/?CampaignName=stichsaege_set
  75. No text
    https://eshop.wuerth.at/EWS-Set-Basic-WNKLSHLF-EL-SET-EWS7-125-BASIC-51TLG/5988000293.sku/de/DE/EUR/?CampaignName=ewsbasic_set
  76. Weitere Angebote entdecken
    http://wuerth.at/Sonderangebote/Sonderangebote.cyid/Sonderangebote.cgid/de/DE/EUR/
  77. Schrauben Holzanwendungen
    https://eshop.wuerth.at/Produktkategorien/Schrauben-Holzanwendungen/31233508.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  78. Arbeitsplatzausrüstung
    https://eshop.wuerth.at/Produktkategorien/Arbeitsplatzausruestung/31232002.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  79. Schrauben metrisch/Zoll
    https://eshop.wuerth.at/Produktkategorien/Schrauben-metrisch-Zoll/31233511.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  80. Reinigungs- u. Pflegemittel
    https://eshop.wuerth.at/Produktkategorien/Reinigungs-u.-Pflegemittel/31233007.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  81. Bohrer und Meißel
    https://eshop.wuerth.at/Produktkategorien/Bohrer-und-Meissel/31237501.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  82. Messwerkzeuge
    https://eshop.wuerth.at/Produktkategorien/Messwerkzeuge/31236102.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  83. Elektro-Maschinen
    https://eshop.wuerth.at/Produktkategorien/Elektro-Maschinen/31235004.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  84. Klebebänder
    https://eshop.wuerth.at/Produktkategorien/Klebebaender/31233004.cyid/3123.cgid/de/DE/EUR/?CampaignName=UserRecoWelcomeCategories&recotype=c
  85. ASSY® 3.0 blau verzinkt Spanplattenschraube
    https://eshop.wuerth.at/Produktkategorien/ASSY-3.0-Stahl-verzinkt-TG-Senkfraestaschenkopf-AW/31233508071503.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  86. Kunststoff-Allzweckdübel SHARK® Pro
    https://eshop.wuerth.at/Produktkategorien/Kunststoff-Allzweckduebel-Shark-Pro/31234501030110.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  87. WÜTOX Senkkopf Teilgewinde TX Holzschraube
    https://eshop.wuerth.at/Produktkategorien/WUePOFAST-2.0-Stahl-verzinkt-TG-Senkfraestasche-TX/31233508071525.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  88. Schutzhandschuh Nitril Tigerflex Plus
    https://eshop.wuerth.at/Produktkategorien/Schutzhandschuh-Nitril-Tigerflex-Plus/31230504090523.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  89. Sechskantmutter
    https://eshop.wuerth.at/Produktkategorien/DIN-934-Stahl-I6I-I8I-verzinkt/31233512120101.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  90. Hammerbohrer Plus Quadro-L Vario
    https://eshop.wuerth.at/Produktkategorien/Hammerbohrer-Plus-Quadro-L-Vario/31237501050710.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  91. Kabelbinder Standard mit Kunststoffzungenverschluss
    https://eshop.wuerth.at/Produktkategorien/Kabelband-mit-Kunststoffzunge/31235504010201.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  92. Müllsack
    https://eshop.wuerth.at/Produktkategorien/Muellsack-ohne-Zugband/31232002230505.cyid/3123.cgid/de/DE/EUR/?CampaignName=topseller&RecoId=box1%40topsellercategoriesA
  93. No text
    https://news.wuerth.at/werkstattwagen/
  94. Mehr lesen
    https://news.wuerth.at/werkstattwagen/
  95. No text
    https://news.wuerth.at/clickandcollect/
  96. Mehr lesen
    https://news.wuerth.at/clickandcollect/
  97. No text
    https://news.wuerth.at/ihre-persoenliche-informationsdrehscheibe/
  98. Mehr lesen
    https://news.wuerth.at/ihre-persoenliche-informationsdrehscheibe/
  99. No text
    https://www.wuerth.at/de/wuerth_at/services/eprocurement/wuerth_app/wuerth_app_1.php?CampaignName=app_startpage
  100. Bestellvorlagen
    https://news.wuerth.at/immer-wieder-benoetigte-artikel-stets-griffbereit/
  101. Kostenstellenmanagement
    https://news.wuerth.at/artikel-und-kostenstellenbarcodes-erstellen-mit-dem-wuerth-online-shop/
  102. Genehmigungsverfahren
    https://news.wuerth.at/wuerth-online-shop-bestellungen-mehrerer-benutzer-zentral-freigeben/
  103. Budgetverwaltung
    https://news.wuerth.at/ausgaben-einzelner-benutzer-im-wuerth-online-shop-mittels-budgets-steuern/
  104. Click & Collect
    https://www.wuerth.at/de/wuerth_at/services/eprocurement/click___collect/click___collect.php
  105. chemisch-technische Produkte
    https://eshop.wuerth.at/Gesamtkatalog/Chemisch-technische-Produkte/312330.cyid/3123.cgid/de/DE/EUR/
  106. Arbeitskleidung
    https://eshop.wuerth.at/Gesamtkatalog/Arbeitsbekleidung/31230506.cyid/3123.cgid/de/DE/EUR/
  107. Würth Shops
    https://www.wuerth.at/de/wuerth_at/niederlassungen/kundenzentrumsfinder/niederlassungsfinder.php
  108. Schrauben
    https://eshop.wuerth.at/Gesamtkatalog/Schrauben-Holzanwendungen/31233508.cyid/3123.cgid/de/DE/EUR/
  109. Dübeltechnik
    https://www.wuerth.at/duebeltechnik
  110. Beschlägen
    https://eshop.wuerth.at/Gesamtkatalog/Beschlaege/312315.cyid/3123.cgid/de/DE/EUR/
  111. Bohrschrauben
    https://eshop.wuerth.at/Gesamtkatalog/Bohrmaschinen-Elektro/3123500403.cyid/3123.cgid/de/DE/EUR/
  112. Sicherheitsschuhen
    https://eshop.wuerth.at/Gesamtkatalog/Sicherheitsschuhe/3123050701.cyid/3123.cgid/de/DE/EUR/
  113. persönlicher Schutzausrüstung
    https://eshop.wuerth.at/Gesamtkatalog/Persoenliche-Schutzausruestung/31230504.cyid/3123.cgid/de/DE/EUR/
  114. Innenausbau
    https://www.wuerth.at/innenausbau
  115. Werkzeugkoffer
    https://eshop.wuerth.at/Gesamtkatalog/Werkzeugkoffer/3123200902.cyid/3123.cgid/de/DE/EUR/
  116. Trennscheiben
    https://eshop.wuerth.at/Gesamtkatalog/Trennscheibe-gebunden/312375090202.cyid/3123.cgid/de/DE/EUR/
  117. Schweißerbrillen
    https://eshop.wuerth.at/Gesamtkatalog/Schweisserbrille/312305040208.cyid/3123.cgid/de/DE/EUR/
  118. Schraubendrehern
    https://eshop.wuerth.at/Gesamtkatalog/Schraubendreher-Sortiment/312360130404.cyid/3123.cgid/de/DE/EUR/
  119. Shops
    https://www.wuerth.at/de/wuerth_at/niederlassungen/kundenzentrumsfinder/niederlassungsfinder.php
  120. WÜRTH Abo
    https://www.wuerth.at/abo
  121. WÜRTH App
    https://www.wuerth.at/app
  122. Muttern
    https://eshop.wuerth.at/Gesamtkatalog/Schrauben-Scheiben-Muttern-Sortimente/3123350403.cyid/3123.cgid/de/DE/EUR/
  123. Lagersysteme
    https://eshop.wuerth.at/Gesamtkatalog/Lagersysteme/31232007.cyid/3123.cgid/de/DE/EUR/
  124. bewerben Sie sich auf eine der zahlreichen Stellen
    https://www.wuerth.at/karriere
  125. Karriere
    https://www.wuerth.at/de/karriere/karriere.php
  126. AGB
    https://www.wuerth.at/de/wuerth_at/agb_1/terms.php
  127. Impressum
    https://www.wuerth.at/de/wuerth_at/impressum_1/legal.php
  128. Datenschutz
    https://www.wuerth.at/de/wuerth_at/datenschutz/privacy.php
  129. Arbeitsschutz
    https://eshop.wuerth.at/Gesamtkatalog/Arbeitsschutz/312305.cyid/3123.cgid/de/DE/EUR/
  130. Baubedarf
    https://eshop.wuerth.at/Gesamtkatalog/Baubedarf/312310.cyid/3123.cgid/de/DE/EUR/
  131. Beschläge
    https://eshop.wuerth.at/Gesamtkatalog/Beschlaege/312315.cyid/3123.cgid/de/DE/EUR/
  132. Betriebsausrüstung
    https://eshop.wuerth.at/Gesamtkatalog/Betriebsausruestung/312320.cyid/3123.cgid/de/DE/EUR/
  133. Bolzenschubtechnik
    https://eshop.wuerth.at/Gesamtkatalog/Bolzenschubtechnik/312340.cyid/3123.cgid/de/DE/EUR/
  134. Brandschutz
    https://eshop.wuerth.at/Gesamtkatalog/Brandschutz/312325.cyid/3123.cgid/de/DE/EUR/
  135. Chemisch-technische Produkte
    https://eshop.wuerth.at/Gesamtkatalog/Chemisch-technische-Produkte/312330.cyid/3123.cgid/de/DE/EUR/
  136. Dübeltechnik
    https://eshop.wuerth.at/Gesamtkatalog/Duebeltechnik/312345.cyid/3123.cgid/de/DE/EUR/
  137. Elektroinstallation
    https://eshop.wuerth.at/Gesamtkatalog/Elektroinstallation/312355.cyid/3123.cgid/de/DE/EUR/
  138. Fahrzeugeinrichtungen und Zubehör
    https://eshop.wuerth.at/Gesamtkatalog/Fahrzeugeinrichtungen-und-Zubehoer/312356.cyid/3123.cgid/de/DE/EUR/
  139. Handwerkzeuge
    https://eshop.wuerth.at/Gesamtkatalog/Handwerkzeuge/312360.cyid/3123.cgid/de/DE/EUR/
  140. KFZ-Teile
    https://eshop.wuerth.at/Gesamtkatalog/KFZ-Teile/312365.cyid/3123.cgid/de/DE/EUR/
  141. Landwirtschaftsprodukte
    https://eshop.wuerth.at/Gesamtkatalog/Landwirtschaftsprodukte/312385.cyid/3123.cgid/de/DE/EUR/
  142. Löten und Schweißen
    https://eshop.wuerth.at/Gesamtkatalog/Loeten-und-Schweissen/312370.cyid/3123.cgid/de/DE/EUR/
  143. Maschinen
    https://eshop.wuerth.at/Gesamtkatalog/Maschinen/312350.cyid/3123.cgid/de/DE/EUR/
  144. Materialbearbeitung
    https://eshop.wuerth.at/Gesamtkatalog/Materialbearbeitung-maschinell/312375.cyid/3123.cgid/de/DE/EUR/
  145. Messtechnik
    https://eshop.wuerth.at/Gesamtkatalog/Messtechnik/312361.cyid/3123.cgid/de/DE/EUR/
  146. ORSY System
    https://eshop.wuerth.at/Produktkategorien/ORSY-System/312322.cyid/3123.cgid/de/DE/EUR/
  147. Sanitär, Heizung, Klima
    https://eshop.wuerth.at/Gesamtkatalog/Sanitaer-Heizung-Klima/312380.cyid/3123.cgid/de/DE/EUR/
  148. Verbindungselemente
    https://eshop.wuerth.at/Gesamtkatalog/Verbindungselemente/312335.cyid/3123.cgid/de/DE/EUR/
  149. Werbemittel
    https://eshop.wuerth.at/Produktkategorien/Werbemittel/312395.cyid/3123.cgid/de/DE/EUR/
  150. Code of Compliance
    https://www.wuerth.at/de/wuerth_at/company/das_unternehmen/code_of_compliance/codeofcompliance.php
  151. Sponsoring
    https://www.wuerth.at/de/wuerth_at/company/sponsoring/sponsoring_1.php
  152. Sportsponsoring
    https://www.wuerth.at/de/wuerth_at/company/sportsponsoring/sportsponsoring_1.php
  153.  Würth Shop finden
    https://www.wuerth.at/de/wuerth_at/niederlassungen/kundenzentren_a_z/kundenzentren_neu.php
  154. Warenkorb
    https://eshop.wuerth.at/is-bin/INTERSHOP.enfinity/WFS/3123-B1-Site/de_DE/-/EUR/ViewCurrentReq-UnregisterPageable?
  155. Magazin
    http://news.wuerth.at
  156. hier
    https://www.wuerth.at/de/wuerth_at/datenschutz/cookies.php
  157. Datenschutzerklärung
    https://www.wuerth.at/de/wuerth_at/datenschutz/privacy.php
  158. No text
    https://www.wuerth.at/de/wuerth_at/datenschutz/privacy.php

Links - Internal (nofollow)

0:

Links - Outbound

5:
  1. Sportsponsoring
    https://www.wuerth.com/web/de/wuerthcom/engagement/sportsponsoring_2/sportsponsoring.php
  2. Schleifpapier
    https://eshop.wuerth.de/Gesamtkatalog/Schleifstreifen/1401750609.cyid/1401.cgid/de/DE/EUR/
  3. No text
    http://www.wuerth.com
  4. No text
    https://apps.apple.com/at/app/w%C3%BCrth-%C3%B6sterreich/id1502269197
  5. No text
    https://play.google.com/store/apps/details?id=at.wuerth.customerapp&gl=AT

Links - Outbound (nofollow)

0:

Keyword Cloud for Wuerth.at

kundeninnerhalb vonvieleszurbietet ihnenverfgung50 wrthsuchbegriffhochwertigefr denmaterialbearbeitungseinmit demsindauf dereinsystemlsungenwarenkorbwrth istihnenunser5lieferungkeinecteile managementaus einer handweltweitlagersystemeder wrtheinstellungendabeisie diese50 8242wenn sieimsuchenbieten wirwrth onlineshop43 50 8242sterreichweitwrth shop abholenbeifindenum die uhrbestellungumeineampnebenistihrenalszur verfgunghandanmeldenkundennummersie sichnutzenhandwerkzeugeallesmitrund um diepartnernummer8242 0dreihandelmussdazuschraubensie ihredemfinden sieausunserensichunssondernzuarbeitendatenudie siebisbietetmontage und befestigungsmaterialcollectmehr alsnochproduktenpasswortauf der baustelleunsere kundenbestellencteileregistrierenoderderortallewerdendarum2mehr lesensievonweltdurchsie dieloggedintrueschnellonlineshopunsererfalsewir habenpiwiktrackingenabledauchvar1cookiesknnen sievor ortdaswerkzeugenanwendungender baustellemobilfunknummereinfachganz sterreichjquerydocumentreadyfunctionwirkarrierefunktioniertprofishaben sieobqualittwrth shopchemischtechnische produkteunsereeinenunserer kundenrechnungprodukten frbitteeinerkunstzubehrauf einedie wrthdendie uhrloggedin falseshopim wrthwenn0nurdesdiesepartnervon wrthvieleunternehmenservicesclickeinemwrthrund umverwendenuhrum diechemischtechnischewiebedarfganzartikelproduktsortimentpressedefaultimagenachsoshop abholengewerbetreibendefrmitarbeiterdannsystemabholennichtproduktesind wirbei wrthmehrhierberihrerder wrth onlineshopsondern auchinnerhalbdasssterreichhttpswwwwuerthdewebmediasystemlayoutwl2bootstrapbootstrapsystemimagestouchiconsiclauncherpngichhabengenauvon cookiesjquerydocumentreadyfunction varverwenden sie50 8242 0keiniflsungen3im wrth onlineshopuntershop findenknnenspeichernimmervieles mehrdirektihrewuumlrthmanagementkann4zu denarbeitaberdiezumbietenproduktkategorienservicerundwuerthatonlineapp50 wrth shopsnicht nuraufinformationenarbeitsschutzaus einerbaubedarforsysofortber 50baustelleihremmontageshopsweitere43 50wrth shopseiner handvorhatbrauchenlesenihresfr diebefestigungsmaterial

Longtail Keyword Density for Wuerth.at

KeywordsOccurences
43 50 82425
im wrth online-shop4
50 8242 03
wrth shop abholen3
der wrth online-shop3
50 wrth shops3
montage- und befestigungsmaterial3
rund um die3
um die uhr3
aus einer hand3
auf der baustelle3
wrth online-shop10
sie sich9
bei wrth8
wrth shops8
sie ihre7
50 82426
mehr als6
nicht nur6
im wrth6
wrth shop6
43 505
von wrth5
auf der5
fr den5
knnen sie5
fr die5
finden sie5
rund um4
um die4
wenn sie4
jquerydocumentreadyfunction var4
haben sie4
zu den4
sie die4
ber 504
unsere kunden3
die uhr3
bieten wir3
zur verfgung3
sind wir3
der baustelle3
auf eine3
sondern auch3
vor ort3
einer hand3
wir haben3
unserer kunden3
vieles mehr3
aus einer3
mehr lesen3
produkten fr3
die wrth3
shop finden3
8242 03
die sie3
verwenden sie3
sie diese3
loggedin false3
chemisch-technische produkte3
mit dem3
wrth ist3
c-teile management3
shop abholen3
innerhalb von3
ganz sterreich3
der wrth3
bietet ihnen3
50 wrth3
von cookies3
wrth72
sie68
die41
fr39
der38
zu27
wir27
mit27
oder26
auf26
von24
den21
ihre20
das20
im19
nicht18
knnen17
auch17
var17
unsere16
haben16
ber15
true15
sich15
mehr14
kunden14
ihnen13
false13
ist13
um12
sind12
bei11
online-shop11
011
nur11
eine11
produkte11
shops10
shop10
aus10
ein10
wie9
nach9
als9
zur9
unserer9
unternehmen9
finden9
service8
es8
einen8
jquerydocumentreadyfunction7
alle7
einer7
bis7
werden7
noch7
sterreichweit7
unser7
ganz7
diese7
ihr7
rund6
ihrer6
passwort6
karriere6
16
registrieren6
online6
qualitt6
unseren6
direkt6
des6
warenkorb6
informationen6
cookies6
wenn6
artikel6
einem6
hand5
schrauben5
sondern5
baubedarf5
ihrem5
bieten5
ob5
bietet5
immer5
so5
sterreich5
mobilfunknummer5
produkten5
dem5
25
hat5
35
alles5
45
uhr5
montage-5
produktkategorien4
verwenden4
brauchen4
einstellungen4
baustelle4
wuerthat4
ort4
werkzeugen4
vor4
collect4
befestigungsmaterial4
aber4
systemlsungen4
gewerbetreibende4
click4
produktsortiment4
unter4
app4
daten4
einfach4
bestellen4
httpswwwwuerthdewebmediasystemlayoutwl2bootstrapbootstrapsystemimagestouchiconsiclauncherpng4
weltweit4
partnernummer4
bitte4
if4
welt4
zum4
neben4
ihren4
profis4
sein4
hochwertige4
weitere4
dass4
54
keine4
piwiktrackingenabled3
speichern3
wuumlrth3
partner3
genau3
bestellung3
mitarbeiter3
lagersysteme3
darum3
vieles3
bedarf3
verfgung3
arbeit3
viele3
handel3
zubehr3
dann3
funktioniert3
dazu3
dabei3
muss3
presse3
kunst3
kein3
anmelden3
kundennummer3
sofort3
kann3
hier3
drei3
uns3
nutzen3
rechnung3
ich3
durch3
arbeiten3
suchen3
lieferung3
innerhalb3
chemisch-technische3
abholen3
lesen3
schnell3
orsy3
u3
materialbearbeitung3
handwerkzeuge3
arbeitsschutz3
system3
services3
amp3
suchbegriff3
lsungen3
anwendungen3
loggedin3
c-teile3
management3
defaultimage3

Wuerth.at Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Wuerth.at is a scam?

Websites with Similar Names

Wuerth-elektronik.de
WE Startseite | Würth Elektronik Unternehmensgruppe
Wuerth-industrie.com
Beschaffungskonzepte für C-Teile | Würth Industrie Service
Wuerth-phoenix.com
Würth Phoenix - ERP - CRM und IT-Service Management | Würth Phoenix
Wuerth-q-conference.com
wuerth-q-conference.com -&nbspThis website is for sale! -&nbspwuerth q conference Resources and Information.
Wuerth.at
Startseite Würth Online-Shop
Wuerth.co.th
Request rejected :(
Wuerth.com
Portal | Würth Group
Wuerth.cz
Vítejte u firmy Würth
Wuerth.de
WÜRTH » Ihr Spezialist für Handwerk und Industrie | WÜRTH
Wuerth.events
wuerth.events | Hallo, diese Domain wurde gerade bei Hostpoint gekauft.

Recently Updated Websites

Hermeneiamedia.com 1 second ago.Lemongrovedesigns.com 2 seconds ago.Web2list.com 2 seconds ago.Timelinefashions.com 3 seconds ago.Egresidents.com 3 seconds ago.Tube4.us 3 seconds ago.Spanyolorszag.eu 5 seconds ago.Senecoglobaladvisors.com 6 seconds ago.Panamamoviles.com 6 seconds ago.Leadtheteam.com 7 seconds ago.Cygnussportswear.com 7 seconds ago.Balayagemasters.com 8 seconds ago.Sanallshipping.com 8 seconds ago.Stirlingbikeclub.org.uk 8 seconds ago.Yachtbooker.de 9 seconds ago.Accenttechnosoft.com 9 seconds ago.Bugstonone.com 9 seconds ago.Dog-zone.cz 9 seconds ago.Principalliquidators.com 9 seconds ago.Sweetshinez.com 10 seconds ago.Jcsyseal.com 10 seconds ago.Hamiltonfcu.com 10 seconds ago.Paragon-bg.com 11 seconds ago.Iperbole.bologna.it 11 seconds ago.Bannermakerproforflash.com 13 seconds ago.Wisbafolio.com 13 seconds ago.Eshabs.com 13 seconds ago.Wasabipr.com 13 seconds ago.Thattowcompany.com 14 seconds ago.Dalianmeng.org 14 seconds ago.