Wurmberg-seilbahn.de Website Analysis Summary

Wurmberg-seilbahn.de  |  Wurmbergseilbahn Braunlage - Mit der längsten Seilbahn Norddeutschlands schweben Sie zu Gipfelerlebnissen der besonderen Art
Low trust score  | 
Die Wurmbgerseilbahnist die längste Luftseilbahn in Norddeutschland. Sie ist ist ganzjährig geöffnet und bringt Wintersportler und Wanderer auf den höchsten Berg Niedersachsens.


Rank
47,216
Rating
H
Trust Score
Low Trust Score
Estimated worth
$321,840
Estimated daily income
$447
Estimated monthly income
$13,596
Backlinks
0

Wurmberg-seilbahn.de has a Low Trust Score, and a Statvoo Rank of H.

Wurmberg-seilbahn.de is hosted by Hetzner Online GmbH in Germany.
Wurmberg-seilbahn.de has an IP Address of 213.239.234.118 and a hostname of srv1.79p.de and runs Apache/2.4 web server.

The domain wurmberg-seilbahn.de was registered 201 decades 9 years 4 months ago by , it was last modified 5 years 6 months 4 days ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 47,216 most popular site among over 300 million websites.

Wurmberg-seilbahn.de has a total of 0 backlinks.

Wurmberg-seilbahn.de gets approximately 37,275 unique visitors a day and 223,650 pageviews per day.

Wurmberg-seilbahn.de has an estimated worth of $321,840.
An average daily income of approximately $447, which is wroughly $13,596 per month.

Whois information for wurmberg-seilbahn.de

Full Whois Lookup for Wurmberg-seilbahn.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: wurmberg-seilbahn.de
Nserver: ns1.79p.de
Nserver: ns2.79p.de
Status: connect
Changed: 2013-03-19T15:00:26+01:00

[Tech-C]
Type: PERSON
Name: Steffen Ottow
Organisation: 79pixel
Address: Schulstr. 21
PostalCode: 38315
City: Gielde
CountryCode: DE
Phone: +491783364980
Email: Login to show email
2014-08-13T22:07:12+02:00

[Zone-C]
Type: PERSON
Name: Steffen Ottow
Organisation: 79pixel
Address: Schulstr. 21
PostalCode: 38315
City: Gielde
CountryCode: DE
Phone: +491783364980
Email: Login to show email
2014-08-13T22:07:12+02:00

Who hosts Wurmberg-seilbahn.de?

Wurmberg-seilbahn.de Web Server Information

Hosted IP Address:213.239.234.118
Hosted Hostname:srv1.79p.de
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Apache/2.4

HTTP Header Analysis for Wurmberg-seilbahn.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 24 May 2015 21:23:42 GMT
Server: Apache/2.4
X-Powered-By: PHP/5.6.7-1
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Expires: Fri, 06 Jun 1975 15:10:00 GMT
Vary: User-Agent,Accept-Encoding
Last-Modified: Sun, 24 May 2015 21:23:42 GMT
Content-Encoding: gzip
Content-Length: 5821
Content-Type: text/html; charset=utf-8

Need to find out who hosts Wurmberg-seilbahn.de?

Wurmberg-seilbahn.de Free SEO Report

Website Inpage Analysis for Wurmberg-seilbahn.de

H1 Headings:1
0
H2 Headings:1
2
H3 Headings:1
3
H4 Headings:1
0
H5 Headings:1
0
H6 Headings:1
0
Total IFRAMEs:0
Total Images:16
Google Adsense:Not Applicable
Google Analytics:UA-42461190-1

Keyword Cloud for Wurmberg-seilbahn.de

functiondataitemsoldremoveclassvisible onaftertruelinear durationcrossfade easing linearjquery function documentreadyfunctioneasingitems visible 11 0nonemehrmititemsheight 290functiondata dataitemsoldremoveclassvisibleduration 800 pauseonhoverwrapper classnamedataitemsvisibleaddclassvisible autovisible 1 scrolloncreate functiondatadataitemsaddclassvisible items visiblevonfunctiondatavisible220 heightampdocumentreadyfunctiondataitemsoldremoveclassvisibledataitemsvisibleaddclassvisible auto timeoutdurationfunctiondata dataitemsaddclassvisiblefx crossfadeoncreate functiondata dataitemsaddclassvisibleaktivittenresumecrossfade2berspringenwurmbergharzfxheight3wrapper classname caroufredselwrapperbikepark1fx crossfade easingeasing linearzudurationnbspwidth 220 heightclassnameduration 800istdiedataitemsaddclassvisible itemsonbeforeonafter functiondata dataitemsvisibleaddclassvisiblepauseonhoveroptionsfunctiondata dataitemsaddclassvisible itemsjquery functionnavigation berspringen290 oncreate functiondatagipfelerlebnisslideshowauto timeoutdurationonbefore functiondata dataitemsoldremoveclassvisiblefunctiondata dataitemsoldremoveclassvisible onafteroncreatewidth 220webcamsheight 290 oncreate0nonewidth800 pauseonhoverautoclassname caroufredselwrappererfahrenspeedfunctiondata dataitemsvisibleaddclassvisibledataitemsoldremoveclassvisible onafter functiondataitems visiblevar0onafter functiondatawrappervisible 1functiondata dataitemsvisibleaddclassvisible autoonafterseilbahnnavigationderfunction documentreadyfunctioncrossfade easing290 oncreatescrollif1 scrolljqueryonbefore functiondatadataitemsvisibleaddclassvisiblesiestartcaroufredselwrapperdataitemsaddclassvisiblelinearreturndasder wurmberg800 pauseonhover resume220 height 290timeoutdurationeasing linear durationoffenmehr erfahrenpauseonhover resumelinear duration 800contaothumbscontrols

Longtail Keyword Density for Wurmberg-seilbahn.de

KeywordsOccurences
onbefore functiondata dataitemsoldremoveclassvisible3
800 pauseonhover resume3
duration 800 pauseonhover3
linear duration 8003
functiondata dataitemsoldremoveclassvisible onafter3
dataitemsoldremoveclassvisible onafter functiondata3
wrapper classname caroufredselwrapper3
dataitemsvisibleaddclassvisible auto timeoutduration3
functiondata dataitemsvisibleaddclassvisible auto3
onafter functiondata dataitemsvisibleaddclassvisible3
easing linear duration3
crossfade easing linear3
290 oncreate functiondata3
height 290 oncreate3
220 height 2903
width 220 height3
oncreate functiondata dataitemsaddclassvisible3
functiondata dataitemsaddclassvisible items3
fx crossfade easing3
visible 1 scroll3
items visible 13
dataitemsaddclassvisible items visible3
jquery function documentreadyfunction3
mehr erfahren10
function documentreadyfunction5
jquery function5
onbefore functiondata3
functiondata dataitemsoldremoveclassvisible3
pauseonhover resume3
800 pauseonhover3
dataitemsoldremoveclassvisible onafter3
duration 8003
linear duration3
functiondata dataitemsvisibleaddclassvisible3
wrapper classname3
classname caroufredselwrapper3
auto timeoutduration3
dataitemsvisibleaddclassvisible auto3
easing linear3
onafter functiondata3
1 scroll3
height 2903
290 oncreate3
220 height3
width 2203
der wurmberg3
1 0-none3
oncreate functiondata3
functiondata dataitemsaddclassvisible3
navigation berspringen3
fx crossfade3
visible 13
items visible3
dataitemsaddclassvisible items3
crossfade easing3
der11
erfahren10
010
mehr10
functiondata9
var8
function7
sie7
seilbahn7
jquery6
wurmberg6
documentreadyfunction5
if5
contao-thumbs-controls5
items5
nbsp5
amp4
scroll4
von4
return4
true4
mit4
die4
aktivitten4
visible3
duration3
13
easing3
crossfade3
linear3
fx3
onbefore3
timeoutduration3
wrapper3
classname3
caroufredselwrapper3
auto3
dataitemsvisibleaddclassvisible3
resume3
dataitemsaddclassvisible3
dataitemsoldremoveclassvisible3
onafter3
pauseonhover3
slideshow3
harz3
ist3
das3
bikepark3
gipfelerlebnis3
berspringen3
start3
webcams3
zu3
offen3
23
height3
33
width3
speed3
options3
navigation3
0-none3
oncreate3

What are the nameservers for wurmberg-seilbahn.de?

Wurmberg-seilbahn.de Domain Nameserver Information

HostIP AddressCountry
ns1.79p.de 213.239.234.118Germany Germany
ns2.79p.de 176.9.61.71Germany Germany