Xeno-canto.org Website Information

Website Ranks & Scores for Xeno-canto.org

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:195,083
Majestic Rank Majestic Rank:85,556
Domain Authority Domain Authority:56%
DMOZ DMOZ Listing:No

Whois information for xeno-canto.org

Full Whois Lookup for Xeno-canto.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Xeno-canto.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D106155215-LROR
Registrar WHOIS Server:
Registrar URL: http://www.antagus.de
Updated Date: 2017-04-26T01:47:31Z
Creation Date: 2005-04-25T11:58:49Z
Registry Expiry Date: 2018-04-25T11:58:49Z
Registrar Registration Expiration Date:
Registrar: Vautron Rechenzentrum AG
Registrar IANA ID: 1443
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: C106903768-LROR
Registrant Name: Planque R
Registrant Organization: Stichting xeno-canto
Registrant Street: Broekslootkade 151
Registrant City: Rijswijk
Registrant State/Province: Zuid Holland
Registrant Postal Code: 2281TD
Registrant Country: NL
Registrant Phone: +31.205987832
Registrant Phone Ext:
Registrant Fax: +31.205987832
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C98947717-LROR
Admin Name: Lingen M
Admin Organization: Internet Service Europe Ltd.
Admin Street: Rucphensebaan 30
Admin City: Roosendaal
Admin State/Province: Noord Brabant
Admin Postal Code: 4706PJ
Admin Country: NL
Admin Phone: +31.165318788
Admin Phone Ext:
Admin Fax: +31.165317438
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C98947717-LROR
Tech Name: Lingen M
Tech Organization: Internet Service Europe Ltd.
Tech Street: Rucphensebaan 30
Tech City: Roosendaal
Tech State/Province: Noord Brabant
Tech Postal Code: 4706PJ
Tech Country: NL
Tech Phone: +31.165318788
Tech Phone Ext:
Tech Fax: +31.165317438
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS2.XENO-DNS3.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-20T07:19:40Z

Who hosts Xeno-canto.org?

Xeno-canto.org is hosted by NedZone Internet BV in Noord-brabant, Roosendaal, Netherlands, 4708.
Xeno-canto.org has an IP Address of and a hostname of ns1.xeno-dns3.org.

Xeno-canto.org Web Server Information

Hosted IP Address:
Hosted Hostname:ns1.xeno-dns3.org
Service Provider:NedZone Internet BV
Hosted Country:NetherlandsNL
Location Latitude:51.5308
Location Longitude:4.46528
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Xeno-canto.org

Http-Version: 1.0
Status-Code: 200
Status: 200 OK
Date: Fri, 31 Jul 2015 10:10:25 GMT
Server: Apache/2.2.3 (CentOS)
X-Powered-By: PleskLin
Cache-Control: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Connection: close
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Xeno-canto.org?

Xeno-canto.org Free SEO Report

Website Inpage Analysis for Xeno-canto.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Xeno-canto.org

bird songsxenocanto foundationdetailsyoucosta rica playmoreoutjustkolaassoundseric houghrecordingarticlemichael widmerwouldplay pausewexccollectionjeremyricahough from unitedtimesongsterjevellingastarlingterje kolaasrightreplycommonsharehoughcopy0rica playjacobtodd1junerica play pausevarreallysongbird soundsspecieswillempier vellinganorway play pauseericunited states playplaymichaelcheckwillempiertermscommon starlinglatestsoundmarkfemalefoundationforumstates playstarling by terjeunitedaugustnewcostaunited statesnorway playusrecordingsplantagulawidmerkolaas from norwaypausejune 15your replywidmer from costatherenorwaytheirhelpstates play pausexenocantoyourcosta ricaalldatastateshavebird

Longtail Keyword Density for Xeno-canto.org

states play pause7
kolaas from norway7
united states play7
norway play pause6
rica play pause4
costa rica play4
widmer from costa4
starling by terje3
hough from united3
play pause22
terje kolaas7
states play7
united states7
norway play6
june 155
michael widmer5
your reply4
costa rica4
rica play4
xeno-canto foundation3
common starling3
willem-pier vellinga3
eric hough3
bird sounds3
bird songs3

What are the nameservers for xeno-canto.org?

Xeno-canto.org Domain Nameserver Information

HostIP AddressCountry
ns1.xeno-dns3.org Netherlands
ns2.xeno-dns3.org Netherlands

Xeno-canto.org DNS Record Analysis DNS Lookup

xeno-canto.orgNS86400Target: ns1.xeno-dns3.org
xeno-canto.orgNS86400Target: ns2.xeno-dns3.org
xeno-canto.orgSOA86400MNAME: ns1.xeno-dns3.org
RNAME: bob.xeno-canto.org
Serial: 1352585437
Refresh: 10800
Retry: 3600
Expire: 604800
xeno-canto.orgMX86400Priority: 10
Target: mail.xeno-canto.org
xeno-canto.orgTXT86400TXT: v=spf1 +a +mx ?all

Alexa Traffic Rank for Xeno-canto.org

Alexa Search Engine Traffic for Xeno-canto.org