Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: Sports > Golf



Domain summary

Last updated
2020-11-04
Domain label
xgolf
Domain extension
co.kr
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Xgolf.co.kr registered?
A: Xgolf.co.kr was registered 11 months, 2 weeks, 5 days, 18 hours, 44 minutes, 46 seconds ago on Wednesday, November 4, 2020.
Q: When was the WHOIS for Xgolf.co.kr last updated?
A: The WHOIS entry was last updated 11 months, 2 weeks, 5 days, 18 hours, 44 minutes, 46 seconds ago on Wednesday, November 4, 2020.
Q: What are Xgolf.co.kr's nameservers?
A: DNS for Xgolf.co.kr is provided by the following nameservers:
  • ns5.cninet.co.kr
  • ns6.cninet.co.kr
Q: Who is the registrar for the Xgolf.co.kr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Xgolf.co.kr?
A: Xgolf.co.kr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Xgolf.co.kr each day?
A: Xgolf.co.kr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Xgolf.co.kr resolve to?
A: Xgolf.co.kr resolves to the IPv4 address 183.111.159.149.
Q: In what country are Xgolf.co.kr servers located in?
A: Xgolf.co.kr has servers located in the South Korea.
Q: What webserver software does Xgolf.co.kr use?
A: Xgolf.co.kr is powered by webserver.
Q: Who hosts Xgolf.co.kr?
A: Xgolf.co.kr is hosted by Korea Telecom in South Korea.
Q: How much is Xgolf.co.kr worth?
A: Xgolf.co.kr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Xgolf.co.kr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Xgolf.co.kr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Xgolf.co.kr

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-20226809-1

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Xgolf.co.kr

li spanhtmlfnvnumberaddcommaleftselectval selecttourgreenfeerightfnvgetgolfclublistsareacodevald7d7d7border1px solidlocaltourbox inner26else requesturlmaindetailsearchlayer areabtn lirightselectvalfunction51px10thischildrenspantextindexofthisattrclassli spantextindexof 0elsecheckall52px height20pxif thischildrenspantextindexofrightselecttime elseleftselecttime frightselectval1 rightselecttimeli spanhtmlfnvnumberaddcommaleftselectvalmargin0newgnbwrapselecttourgreenfeeright li spanhtmlfnvnumberaddcommarightselectval38totalsearchlayervar52px height 51pxspanhtmlfnvnumberaddcommarightselectval fleftselectvalul liremoveclasson30positiongetrequesturl functiondata varareabtn liselecttouraraecodevalue0 rightselectvalstrvalueclubnamesearchprocessrightselectval else ifselecttimerightli spanhtmlrightselecttimeval31selectgreenfeelefttranstimespanhtml selectgreenfeerightleftselecttime frightselectval112libindclick function iffalseelse leftselectval fnvlen2zeroparseintthischildrenspantextreplacelifunctionicologinboxlocaltourbox inner localtab2spanhtmlfnvnumberaddcommaleftselectvalspanhtmlfnvnumberaddcommaleftselectval selecttourgreenfeeright limiddotif thischildrenspantext leftselectvalrightselecttimeifdatahiddenlist lilastchildclickmiddot middot middotselectgreenfeeleft li spanhtmlxcashfrightselectval rightselectvalbannerboxnbspnbsp nbspnbspgetrequesturl functiondataareabtnpositionrelativebackgroundposition 20pxarrmainsubareacodeselectgreenfeeright li spantextreplacereplaceselectgreenfeeright liabindclickmaindetailsearchlayerfadeout3008spanhtmlfnvnumberaddcommarightselectvaltextaligncenterfrightselectval1 rightselecttimethischildrenspantextspantextreplacereplace ifselectgreenfeerightholechoicenbspnbspli spanhtmlfnvnumberaddcommarightselectvalnewgnbwrap ul33fleftselectval1 leftselecttimeretourbannermaindetailsearchlayerfadeout300 maindetailsearchlayer btnresettriggerclickli spanhtmlleftselectval 0 rightselectvalif orileftselectvaldocumentreadyfunction40else ifinnerfnvlen2zeroparseintthischildrenspantextreplace10thisattrsrcselecttimeleft li spanhtmlleftselecttimethischildrenspantext leftselectvalleftselectval oririgthselectvalmaindetailsearchlayer ulspanhtmlfnvnumberaddcommaleftselectval selecttourgreenfeeright0arrayabindclick functionselectgreenfeeright li spanhtmlfnvnumberaddcommarightselectvalsolid d7d7d7leftselectvalinnerbox ulxgolf xgolfif thischildrenspantextindexof 0fnvlen2zeroparseintthischildrenspantextreplace rightselectvalimgthisattrclass idfunctionkeylowestlayer innerbox ul25positionabsolute4 5array varlibindclick function varuseridvalthischildrenspantextindexof 0jvsearchdataselecttimeleftfunctiondata var addedformdiv32rightselectval 0newbtnsubmitaddclassdisabled btngrayremoveclassbtngreenxgolful lietcbackgroundpositionrightselectval fnvlen2zeroparseintthischildrenspantextreplaceuialert functiondocumentgetelementbyidcustomselectboxareansbtnboxclassnameuleqispanhtmlrightselecttime fleftselectval1 leftselecttimeborder1px solid d7d7d7ul aindexthisfunctiondata varspanhtmlheight 51pxnorepeat9spanhtmlfnvnumberaddcommaleftselectval selectgreenfeeright lifleftselectval leftselectvalifthishasclassonreturn caseselecttourgoodsdivisareatitlibindclick0 ifbackgroundfffthisattrclass id classnamesplitbannercode1btnresettriggerclickselectgreenfeeleft li15str ifdataleftselecttimeimportantfrightselectval1 rightselecttime elseli uleachdata functionkeyjvsearchdata jvsearchdatanewbtnsubmitremoveclassdisabled0 if thischildrenspantextselectoptionleft 50libindclick function3 4heightspanid classnamesplitbannercode1 srccolorclassname thisattrclass idselecttourgreenfeeleft lispanhtmlleftselecttime selecttimeright li39str str getrequesturlfnvlen2zeroparseintthischildrenspantextreplacespanhtml fleftselectval leftselectvallowestlayerselecttourgreenfeeleftmaindetailsearchlayer ul aindexthisifspanhtmlthischildrenspantextreplaceselecttourgreenfeeleft li spanhtmlfnvnumberaddcommaleftselectval41 1105thisremoveclasson elsevar strselecttourgreenfeerightnewbtnsubmitremoveclassdisabled btngrayaddclassbtngreen elselocaltourboxfunctionkey valuemainscrollareaselecttourareacodeli a displayblockfontfamilynanumbarungothicsolid bfbfbfmainscrollarea areabtnselectgoodsdivisdataulul libindclick713idclassnamesplitbannercode1 srcstr strrightselectval else leftselectvalfuparrowholechoice ul limaindetailsearchlayer areabtnrandombannerselecttourareaname2 3 45leftfleftselectval4 5 6btngrayaddclassbtngreendisplaynoneli spanhtmlthischildrenspantextreplacelilastchildclickselectdaylistgetrequesturlalert returncustomselectboxareaclubhtmltruesrc21snslinkleftselectval frightselectval rightselectval3lietcalert return 0width1006maindetailsearchlayer liif ftypethisremoveclasson4 111spanhtmlfnvnumberaddcommarightselectval fleftselectval leftselectvalliaindexthisspanhtml selectgreenfeeright lileftselectval frightselectvalbtngrayremoveclassbtngreenfrightselectvalreturnreturn 0 ifselect uiul li ulauto4jselectlocaltab17if leftselectval oririgthselectvalspanhtmlrightselecttime fleftselectval1else selectgreenfeeleftbfbfbfmontharea1 2 3abindclick function varmaintimesaleiframeareaattrsrcajaxformtimesaleaspprdatetypeftypeinnerboxdivvar addedformdivleftselectval fnvlen2zeroparseintthischildrenspantextreplacelietc divholechoice ulspantextindexof 0if leftselectvaladdedformdiv documentgetelementbyidcustomselectboxareali ul libtngrayaddclassbtngreen else1 1maindetailsearchlayerfrightselectval1function if thischildrenspantextindexofeachdata functionkey valueidx27else selectgreenfeeleft listr getrequesturl functiondataoririgthselectvalname0 maindetailsearchlayerdate3 4 5calendartableaeachfunctionspanhtml fleftselectvalfleftselectval1requesturlmaindetailsearchlayer monthareaselectgreenfeeright li spanhtmlinnerbox ul li1 2calendartable table51px backgroundposition 20pxlifirstchildclickspanhtmlleftselecttimequickbannerleftmaindetailsearchlayerfadeout300 maindetailsearchlayer37displayblockfleftselectval leftselectval frightselectval51px backgroundpositionul libindclick function22selecttourgreenfeeright lifnvloginokbanneragentclickaddattrsrcmaindetailsearchlayer uleqi2416orileftselectval rightselectvalstrvalueclubname str5 6li spanhtmlfnvnumberaddcommaleftselectval selectgreenfeerightif orileftselectval rightselectvalreturn falseorileftselectvalspanhtmlrightselecttimecasemaindetailsearchlayer calendartable tableselectoption uluseridselecttimeleft li36li spanhtmlfnvnumberaddcommarightselectval fleftselectvalxgolf xgolf xgolfalertwidth 52px2 3consolelogcolor6d6d6dnewbtnsubmitremoveclassdisabled btngrayaddclassbtngreenmainsearchareaid classnamesplitbannercode1var addedformdiv documentgetelementbyidcustomselectboxareali spanhtmlleftselecttime selecttimerighthiddenlist lifirstchildclickthischildrenspantext leftselectval 0selecttimeright limargin0 autoquickbannerlayertopbtnselectgreenfeeleft li spanhtmlfnvnumberaddcommaleftselectval1userpassvalfunction ifspanhtmlfnvnumberaddcommaleftselectval selectgreenfeerightli spanhtmlleftselecttimeareabtnlongfontweightboldul lietc divtableborder1pxwidth 52px heightli spanhtmlrightselecttime fleftselectval1else leftselectval23li spanhtml fleftselectval0 alert returnquicksearchtabstrnewlocalpathmaindetailsearchlayer calendartableeachdatanew array18widthmainscrollarea areatitli spanhtml selectgreenfeeright2 returnif thischildrenspantextaddedformdivul lileftselectval fnvlen2zeroparseintthischildrenspantextreplace rightselectvalliremoveclassonwidth287pxsubnavstr getrequesturlthisaddclassonselectbookaraecode52pxspanhtmlleftselecttime selecttimerightlocaltourbox localpathclassnamesplitbannercode1aonlengthlowestlayer innerbox2920solidinner localtabspantextreplacereplacefunction varrightselectval elsefunctiondatali spantextreplacereplace if28return 0middot middotspantextindexofgnblinehiddenlist34classname thisattrclassli spantextindexof14selecttimeright li spanhtmlrightselecttimevar idx19new datenewbtnsubmitaddclassdisabled350 alertftypefleftselectval1 leftselecttime frightselectval1leftselectval 0height 51px backgroundpositionmaindetailsearchlayer btnresettriggerclickmaindetailsearchlayer selectdaylistvar str strli spantextreplacereplacefrightselectval rightselectval else

Longtail Keyword Density for Xgolf.co.kr

KeywordsOccurences
frightselectval rightselectval else16
leftselectval frightselectval rightselectval13
fleftselectval leftselectval frightselectval13
li spanhtmlfnvnumberaddcommarightselectval fleftselectval10
spanhtmlfnvnumberaddcommarightselectval fleftselectval leftselectval10
maindetailsearchlayer calendartable table8
ul libindclick function8
alert return 07
selectgreenfeeright li spanhtmlfnvnumberaddcommarightselectval7
selectgreenfeeleft li spanhtml7
ul li ul7
if thischildrenspantextindexof 06
rightselectval else leftselectval5
selectgreenfeeleft li spanhtmlfnvnumberaddcommaleftselectval5
li spantextreplacereplace if5
middot middot middot5
selecttourgreenfeeleft li spanhtmlfnvnumberaddcommaleftselectval5
li spantextindexof 05
selecttourgreenfeeright li spanhtmlfnvnumberaddcommarightselectval5
ul lietc div5
return 0 if5
holechoice ul li5
libindclick function var4
selectgreenfeeright li spanhtml4
rightselectval else if4
li spanhtmlfnvnumberaddcommaleftselectval selecttourgreenfeeright4
spanhtmlfnvnumberaddcommaleftselectval selecttourgreenfeeright li4
leftselectval fnvlen2zeroparseintthischildrenspantextreplace rightselectval4
2 3 44
newbtnsubmitremoveclassdisabled btngrayaddclassbtngreen else4
spanhtml selectgreenfeeright li4
leftselectval 0 rightselectval4
li spanhtml selectgreenfeeright4
else selectgreenfeeleft li4
libindclick function if4
0 if thischildrenspantext4
0 alert return4
function if thischildrenspantextindexof4
selecttimeleft li spanhtmlleftselecttime4
selecttimeright li spanhtmlrightselecttime4
52px height 51px3
eachdata functionkey value3
1 2 33
3 4 53
4 5 63
width 52px height3
maindetailsearchlayerfadeout300 maindetailsearchlayer btnresettriggerclick3
height 51px background-position3
51px background-position -20px3
functiondata var addedformdiv3
li a displayblock3
maindetailsearchlayer areabtn li3
border1px solid d7d7d73
maindetailsearchlayer ul aindexthis3
localtourbox inner localtab3
lowestlayer innerbox ul3
innerbox ul li3
li ul li3
xgolf xgolf xgolf3
var addedformdiv documentgetelementbyidcustomselectboxarea3
id classnamesplitbannercode1 src3
getrequesturl functiondata var3
spanhtml fleftselectval leftselectval3
thischildrenspantext leftselectval 03
else leftselectval fnvlen2zeroparseintthischildrenspantextreplace3
if thischildrenspantext leftselectval3
li spanhtmlfnvnumberaddcommaleftselectval selectgreenfeeright3
spanhtmlfnvnumberaddcommaleftselectval selectgreenfeeright li3
selectgreenfeeright li spantextreplacereplace3
frightselectval1 rightselecttime else3
leftselecttime frightselectval1 rightselecttime3
li spanhtml fleftselectval3
fleftselectval1 leftselecttime frightselectval13
str getrequesturl functiondata3
spanhtmlrightselecttime fleftselectval1 leftselecttime3
if orileftselectval rightselectval3
li spanhtmlrightselecttime fleftselectval13
spanhtmlleftselecttime selecttimeright li3
li spanhtmlleftselecttime selecttimeright3
abindclick function var3
classname thisattrclass id3
thisattrclass id classnamesplitbannercode13
var str str3
str str getrequesturl3
if leftselectval oririgthselectval3
frightselectval rightselectval19
selectgreenfeeright li17
fleftselectval leftselectval16
rightselectval else16
selectgreenfeeleft li15
ul li14
leftselectval frightselectval13
li spanhtmlfnvnumberaddcommarightselectval12
border1px solid11
li spanhtml11
function var11
spanhtmlfnvnumberaddcommarightselectval fleftselectval10
li spanhtmlfnvnumberaddcommaleftselectval10
libindclick function9
else if9
li spantextreplacereplace9
maindetailsearchlayer calendartable9
0 if9
newgnbwrap ul8
alert return8
calendartable table8
ul libindclick8
localtourbox inner7
middot middot7
li ul7
selecttourgreenfeeright li7
selecttourgreenfeeleft li7
return 07
4 17
selecttimeleft li6
margin0 auto6
if thischildrenspantext6
maindetailsearchlayer selectdaylist6
return case6
jvsearchdata jvsearchdata6
selecttimeright li6
else leftselectval6
thischildrenspantextindexof 06
if thischildrenspantextindexof6
spantextreplacereplace if5
if orileftselectval5
holechoice ul5
background-position -20px5
maindetailsearchlayer montharea5
maindetailsearchlayer areabtn5
areabtn li5
maindetailsearchlayer ul5
xgolf xgolf5
ul lietc5
array var5
spantextindexof 05
li spantextindexof5
lietc div5
lowestlayer innerbox5
2 34
spanhtmlfnvnumberaddcommaleftselectval selecttourgreenfeeright4
hiddenlist lifirst-childclick4
btngrayaddclassbtngreen else4
thisremoveclasson else4
41 11054
1 14
3 44
selectoption ul4
str str4
maindetailsearchlayer uleqi4
newbtnsubmitremoveclassdisabled btngrayaddclassbtngreen4
hiddenlist lilast-childclick4
0 rightselectval4
fleftselectval1 leftselecttime4
li spanhtmlleftselecttime4
function if4
spanhtml selectgreenfeeright4
maindetailsearchlayer btnresettriggerclick4
li spanhtmlrightselecttime4
frightselectval1 rightselecttime4
else selectgreenfeeleft4
leftselectval 04
fnvlen2zeroparseintthischildrenspantextreplace rightselectval4
li spanhtmlthischildrenspantextreplace4
0 alert4
new array4
rightselectval fnvlen2zeroparseintthischildrenspantextreplace4
return false4
newbtnsubmitaddclassdisabled btngrayremoveclassbtngreen4
leftselectval fnvlen2zeroparseintthischildrenspantextreplace4
leftselecttime frightselectval13
orileftselectval rightselectval3
solid bfbfbf3
solid d7d7d73
rightselecttime else3
spanhtmlrightselecttime fleftselectval13
spanhtmlleftselecttime selecttimeright3
maindetailsearchlayer li3
mainscrollarea areatit3
mainscrollarea areabtn3
ul aindexthis3
select ui3
left 503
localtourbox localpath3
maindetailsearchlayerfadeout300 maindetailsearchlayer3
inner localtab3
if ftype3
ul liremoveclasson3
innerbox ul3
0 maindetailsearchlayer3
height 51px3
thischildrenspantext leftselectval3
var str3
rightselectval 03
spanhtml fleftselectval3
leftselectval oririgthselectval3
if leftselectval3
abindclick function3
spanhtmlfnvnumberaddcommaleftselectval selectgreenfeeright3
2 return3
new date3
var idx3
classname thisattrclass3
thisattrclass id3
id classnamesplitbannercode13
classnamesplitbannercode1 src3
else requesturl3
str getrequesturl3
51px background-position3
getrequesturl functiondata3
functiondata var3
var addedformdiv3
addedformdiv documentgetelementbyidcustomselectboxarea3
eachdata functionkey3
functionkey value3
strvalueclubname str3
str ifdata3
alert function3
1 23
4 53
5 63
width 52px3
52px height3
nbspnbsp nbspnbsp3
li94
var85
else63
058
function58
if53
ul52
maindetailsearchlayer52
rightselectval37
leftselectval32
130
return24
selectgreenfeeright21
frightselectval20
fleftselectval20
alert19
localtourbox18
selectgreenfeeleft17
selecttouraraecode15
xgolf15
solid14
jvsearchdata13
new13
213
312
icologinbox12
middot12
spanhtmlfnvnumberaddcommarightselectval12
412
str12
border1px11
spanhtml11
lowestlayer10
mainscrollarea10
spanhtmlfnvnumberaddcommaleftselectval10
510
69
selecttourgreenfeeright9
selecttourgreenfeeleft9
id9
calendartable9
libindclick9
areabtn9
orileftselectval9
spantextreplacereplace9
text-aligncenter9
auto9
thischildrenspantext8
leftselecttime8
hiddenlist8
selecttimeleft8
displayblock8
fnvlen2zeroparseintthischildrenspantextreplace8
table8
newgnbwrap8
selecttimeright8
value8
rightselecttime8
77
important7
true7
nbspnbsp7
subnav7
87
array7
case7
localpath7
inner7
requesturl7
localtab7
97
width1007
oririgthselectval7
106
116
thischildrenspantextindexof6
-20px6
fleftselectval16
xcash6
arrmainsubareacode6
gnbline6
thisaddclasson6
selectbookaraecode6
selectdaylist6
src6
frightselectval16
margin06
div6
innerbox5
retourbanner5
left5
height5
125
width5
lietc5
135
145
positionabsolute5
background-position5
155
montharea5
165
documentreadyfunction5
selecttourgoodsdivis5
holechoice5
consolelog5
j5
selecttourareaname5
selecttourareacode5
false5
spantextindexof5
thisremoveclasson5
functiondata5
174
aonlength4
184
selectgoodsdivisdata4
newbtnsubmitaddclassdisabled4
194
btnresettriggerclick4
btngrayremoveclassbtngreen4
span4
uleqi4
position4
lilast-childclick4
lifirst-childclick4
btngrayaddclassbtngreen4
color6d6d6d4
bannerbox4
randombanner4
spanhtmlthischildrenspantextreplace4
spanhtmlleftselecttime4
backgroundfff4
204
spanhtmlrightselecttime4
newbtnsubmitremoveclassdisabled4
214
date4
224
ifdata4
userpassval4
mainsearcharea4
234
244
customselectboxareaclubhtml4
useridval4
254
selectoption4
264
274
checkall4
284
aindexthis4
transtime3
293
snslink3
areabtnlong3
303
fnvgetgolfclublistsareacodeval3
areatit3
nsbtnbox3
displaynone3
aeachfunction3
313
thisattrsrc3
ftype3
liremoveclasson3
323
totalsearchlayer3
333
343
quickbannerleft3
searchprocess3
maintimesaleiframeareaattrsrcajaxformtimesaleaspprdatetypeftype3
quickbannerlayertopbtn3
font-weightbold3
name3
d7d7d73
eachdata3
353
img3
color3
fnvloginok3
no-repeat3
strvalueclubname3
functionkey3
documentgetelementbyidcustomselectboxarea3
quicksearchtab3
addedformdiv3
getrequesturl3
userid3
classnamesplitbannercode13
classname3
banner-agent-click-addattrsrc3
val3
363
373
maindetailsearchlayerfadeout3003
fnvlen2zeroparseintthischildrenspantextreplace103
bfbfbf3
lifunction3
positionrelative3
select3
ui3
width287px3
font-familynanumbarungothic3
idx3
383
fuparrow3
51px3
52px3
abindclick3
ifthishasclasson3
393
403
thisattrclass3

Who hosts Xgolf.co.kr?

Xgolf.co.kr Hosting Provider Information

Hosted IP Address:183.111.159.149
Hosted Hostname:183.111.159.149
Service Provider:Korea Telecom
Hosted Country:South KoreaKR
Location Latitude:37.5112
Location Longitude:126.9741
Webserver Software:Not Applicable

Is "Korea Telecom" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Korea Telecom
0.1328%

HTTP Header Analysis for Xgolf.co.kr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html
Date: Wed, 04 Nov 2020 02:31:38 GMT
Content-Length: 220487

Xgolf.co.kr Domain Nameserver Information

HostIP AddressCountry
ns5.cninet.co.kr 61.100.13.145
ns6.cninet.co.kr 61.100.13.46


Need to find out who hosts Xgolf.co.kr?


Domain Registration (WhoIs) information for Xgolf.co.kr

 query : xgolf.co.kr

# KOREAN(UTF8)

도메인이름 : xgolf.co.kr
등록인 : 조성준
책임자 : 조성준
책임자 전자우편 : Login to show email
: 2003. 03. 21.
최근 정보 변경일 : 2016. 05. 25.
사용 종료일 : 2022. 03. 21.
정보공개여부 : N
등록대행자 : (주)아이네임즈(http://www.inames.co.kr)
DNSSEC : 미서명

1차 네임서버 정보
호스트이름 : ns5.cninet.co.kr
IP 주소 : 61.100.13.145

2차 네임서버 정보
호스트이름 : ns6.cninet.co.kr
IP 주소 : 61.100.13.46

네임서버 이름이 .kr이 아닌 경우는 IP주소가 보이지 않습니다.

# ENGLISH

Domain Name : xgolf.co.kr
Registrant : sungjcho
Administrative Contact(AC) : sungjcho
AC E-Mail : Login to show email
Date : 2003. 03. 21.
Last Updated Date : 2016. 05. 25.
Expiration Date : 2022. 03. 21.
Publishes : N
Authorized Agency : Inames Co., Ltd.(http://www.inames.co.kr)
DNSSEC : unsigned

Primary Name Server
Host Name : ns5.cninet.co.kr
IP Address : 61.100.13.145

Secondary Name Server
Host Name : ns6.cninet.co.kr
IP Address : 61.100.13.46

- KISA/KRNIC WHOIS Service -

Websites with Similar Names

Xgolfannarbor.com
Golf Simulators | Indoor Golf Simulator Technology | Golf Experience
Xgolfannarbor.net
High Tech Simulators with Great Teaching Pros - X-Golf Ann Arbor
Xgolfblaine.com
X Golf Blaine – X Golf Blaine
Xgolfchamplin.com
X Golf Champlin – X Golf Champlin
Xgolfclubs.com
X Golf Clubs Shop | X Golf Clubs
Xgolfco.com
news pole - latest news

Recently Updated Websites

Floodlightdaily.com (5 seconds ago.)Aaronneinstein.com (5 seconds ago.)Globalasiamining.com (6 seconds ago.)Redfernwild.com (8 seconds ago.)Porsche-lorient.fr (9 seconds ago.)Prn-solutions.net (10 seconds ago.)Bcn.org.nz (10 seconds ago.)Ducatiofsb.com (13 seconds ago.)Kettlebell.rocks (14 seconds ago.)Centralairlongisland.com (16 seconds ago.)Gigl.org (16 seconds ago.)Dudesbareback.com (16 seconds ago.)Lesvoixdeleconomie.net (17 seconds ago.)Kftx.com (18 seconds ago.)Effectivewrestling.com (22 seconds ago.)Outbackbuilders.com (23 seconds ago.)Churchfact.com (25 seconds ago.)Idukigold.com (28 seconds ago.)Buyabstractartonline.com (31 seconds ago.)2489bob.com (32 seconds ago.)Haitisbs.com (34 seconds ago.)Ycjpch.com (34 seconds ago.)Orilux.com (37 seconds ago.)Dragonblood.org (37 seconds ago.)Biaoguanjiaozhanzhipin.com (37 seconds ago.)Plasticsurgerylearning.com (37 seconds ago.)Mamaweva.com (38 seconds ago.)Sesutq.com (40 seconds ago.)Superdieta.net (41 seconds ago.)Ccbusinesscenter.com (42 seconds ago.)

Recently Searched Keywords

apple software update error code 4000 (3 seconds ago.)visual effects software (8 seconds ago.)電磁波 (10 seconds ago.)home & decor moreno valley (12 seconds ago.)show me more (13 seconds ago.)comm 101 module answers (14 seconds ago.)etiquette meaning (22 seconds ago.)gallery reviews (23 seconds ago.)reklam yüzlerimiz (23 seconds ago.)micrometers (25 seconds ago.)overnight rv parking (27 seconds ago.)edp fresh (28 seconds ago.)huile de ricin visage poils (30 seconds ago.)������ ���������� �������������� (30 seconds ago.)hp 45a si ( yeni muadil) solvent kartuş (32 seconds ago.)representing (34 seconds ago.)uborka domov (36 seconds ago.)srebro (39 seconds ago.)floatbgcolor floatheight floatheighttype (43 seconds ago.)hnph kintp (46 seconds ago.)30 ml 750 (46 seconds ago.)up hosting (49 seconds ago.)hedgehogs (51 seconds ago.)da darkages (52 seconds ago.)isabort sreadystate (55 seconds ago.)alabama football a day spring game 2020 (56 seconds ago.)decoration ideas (1 minute 1 second ago.)sondages r (1 minute 2 seconds ago.)vinscon construction llc (1 minute 2 seconds ago.)sundra bhabhi : aise hd1000 movies free dekhne ki liye hamre website 2ullu.com par dekho (1 minute 3 seconds ago.)