Yacht.de  |  YACHT online - Europas grösstes Segelmagazin im Netz | YACHT.DE
Low trust score  | 
Yacht Magazin

Yacht.de Website Information

Yacht.de has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 97,920, a Majestic Rank of 133,196, a Domain Authority of 65% and is not listed in DMOZ.

Yacht.de is hosted by teuto.net Netzdienste GmbH in Nordrhein-westfalen, Bielefeld, Germany, 33602.
Yacht.de has an IP Address of 212.8.200.162 and a hostname of 212.8.200.162 and runs nginx/0.7.65 web server.

The domain yacht.de was registered 201 decades 9 years 1 day ago by , it was last modified 1 decade 2 months 2 weeks ago and currently is set to expire 201 decades 9 years 1 day ago.


Whois information for yacht.de

Full Whois Lookup for Yacht.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: yacht.de
Nserver: ns1.adns2.de
Nserver: ns2.adns2.de
Status: connect
Changed: 2007-02-01T13:48:32+01:00

[Tech-C]
Type: ROLE
Name: Hostmaster Hostweb
Organisation: Hostserver GmbH
Address: www.hostweb.de
Address: Biegenstr.20
PostalCode: 35037
City: Marburg
CountryCode: DE
Phone: +49.6421.924160
Fax: +49.6421.924165
Email: Login to show email
2016-04-27T18:25:59+02:00

[Zone-C]
Type: ROLE
Name: Hostmaster Hostweb
Organisation: Hostserver GmbH
Address: www.hostweb.de
Address: Biegenstr.20
PostalCode: 35037
City: Marburg
CountryCode: DE
Phone: +49.6421.924160
Fax: +49.6421.924165
Email: Login to show email
2016-04-27T18:25:59+02:00

Who hosts Yacht.de?

Yacht.de Web Server Information

Hosted IP Address:212.8.200.162
Hosted Hostname:212.8.200.162
Service Provider:teuto.net Netzdienste GmbH
Hosted Country:GermanyDE
Location Latitude:52.0333
Location Longitude:8.53333
Webserver Software:nginx/0.7.65

HTTP Header Analysis for Yacht.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/0.7.65
Date: Mon, 13 Jul 2015 22:44:06 GMT
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.3.10-1ubuntu3.19
Cache-Control: max-age=0
Expires: Mon, 13 Jul 2015 22:42:36 GMT
X-Varnish: 2051535530 2051532750
Age: 88
Via: 1.1 varnish
Content-Encoding: gzip


Need to find out who hosts Yacht.de?

Yacht.de Free SEO Report

Website Inpage Analysis for Yacht.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yacht.de

langdas erstesie schon 24072017fr die einhandregattaihresgleichen1bilder eines ungewhnlichtastaturexklusivtest der neuenklebmanein bisschentraditionellenvolvo oceander hanseauf der flensburgerfehlersalonfhig zu11082017 haikutterregattazahlreiche klassiker zusammen5besten bilder 15082017allerder yachthandwerkliche baukunstkannausgabe bestellenkontaktwerkder schimmel zurckfotos vom exklusivtestles sables dolonneeindrcke von denpanoramabestellen heft abonnierenvom 10kamenweltmarktfhrer46diesenfuauf 40ist viel losseries zursailing conductorssteigerarbeiten und eindrcke31fuvergleichspieledehlya 25kamen zahlreicheallemsachelesjahre lang sind48gesegeltamp action seemannschaftnrv auf dermediawir habenpanorama regattanewsdigitalostseeweltmarktfhrer beneteausee ichjozef kubicatausche tastaturdigitales magazin heftarchivwocheteakdeckwieder machen 15082017starke eindrckeganzeinsspiele alle newskoszu machenprobefahrtschocksich nichtexklusivtest derammersee 1906201722bordbilanzthemenkomplettyachtfotograf nico kraussdreieckskurs zu44eindrcke ausbeharkten sich crewsmastfoilenvor allemgebauteder typischeneindrckewettfahrtendie bestenlang beharkten sichyacht abonnieren yachtfr die36 karlscupgene vom jollenkreuzerdie ihresgleichen suchtein leben aufgesegelt erstenach der erstendaeindrcke vom 10bootsportrt imsichdoch kommt diezeigtteakdeck teilaus les sableswird nikeman diebisschen wieheftarchivwinschen neue schotennoch einmaldas besonderevon derstartetgesegelt eine bilanzmagazinwird siebootstests gebrauchtbootstestsneue boote bootstestsmit vieldas sofort wieder47im pdfdownloadoperationals erstescup volvo oceandie werftsilverruddersegleryacht abonnierendreieckskursneue winschen neuewolfram heibeck hatvergangenen wochenende kamentrugenolympische spieleelegant dazuabonnieren digital05072017reisedigital abo ausgabehandwerklicheder hamburgernicofoilen sie schonlngerder blackdennoch19062017 amschultzerhl aufseptembermehrdamals43performancecruiserhat nikevon weltmarktfhrerzwei jahredazu mit einerist ein bisschenbigamit deres gibtfigarosail 11082017 haikutterregattaneue ausrstungdeutlichsegeltumbau operation silverruddernike mitkonzepts exklusiv beigaleriereinke neue winschenam vergangenen wochenende15082017 38europameisterschaft aus galerie20072017 dievom zwlferfestclassicstoperste maldeutscheannehmlichkeiten eines tourersmedia cupmapfre13 august istwochenende kamen zahlreicheaugust ist vielgenevier wettfahrten aufrundnaturhafensehrbavariahamburger auenalsterpolen gebaute yachtregattabaycruiser 26ganz alleineines tourerslinieder erstesail 11082017klassiker zusammen umpatient teakdeck teilder 35september die32 frgroender test imnike steiger vlogbeneteau alseinschoten und einseitdie handwerklichetermine blogs alleauf ihrerblauwasser einfrist dieinsmit dem zuknftiggesegelt erste fotosersten bilder eineserstesder neuen beneteauwinschen neuegebrauchtbootstests dasgegenunknownsternenbeiboottag in viersie sichhat ihrenopen 32 frtauwerktestnewsdamitbluesound rasanter xxljollikleinesmitvielesich an einemelbezusammen umdes nrv aufjedermannseemannschaftbeim erstmals ausgetragenenjedenheibeck hatgebaute yachtexklusivamp actionbesondere bootder aktuellensie noch oderfreundenausrstung neuetest amp technikden arbeitenzurck an die15082017 38 jahrereinkeopenles sablesim nordenliebernchsten fahrtenbootgeneration vonzumkieler wochethemen ausgabexxljolli mitsilverrudder diecharteralssich crewsprogramm aufonboardbilder von37gewonnencrews aus dermotorprogramm auf dererfllenteilhefterstensegeltrnichmarketest im pdfdownloadder revierbericht imder ankerplatz erkundetjetzt erhltlich themendie arbeitzahlreiche klassikergastvolvoinhaltsverzeichnisseextreme sailing seriesdigitales magazinein augenschmaussailing series zurihresgleichen sucht dochausrstungstests39sofort wieder machenmachen 15082017 38ganzensteigerswerkstattvom jollenkreuzerstatt16wie weihnachtenberking 12mr europameisterschaftfotos vonfrde ihre robbemartenchartern dieein kleineserhltlich themen ausgabezuknftig derfr dasfr einetrailerbarneue ausrstung ausrstungstestsverlngert fotos vonder bluesoundconductors bis sonntagneue boote neuedie neueteamsablesausgabekleiner bruderdasabo inhaltsverzeichnissenikesihremtastatur gegenelegantfnen auf 40foilen salonfhigtrugen auf derhaiumssailing conductors biskommtleague vendemessen klassikersegeln eindrckeweihnachten fr dievom 10 traditionsklassenmeeting8tageder hanse sailtrngibt esvlog 36 karlspanorama sportbootstypenveranstaltungstipp9auchrevierim filmihre robbeam15082017 wolfram heibeckdehlyazu verlassenlangenargendas sofortchartern die topfactory china182017 jetzthanseyachtstf10schon gesegeltklassikerder erstenampnoch oder foilenkrausstagallesmengezeitbornholmkarls kleinerreiseberichtvlogwenndoch kommtgeht eseuropameisterschaft ausdie extreme sailingdazu mitbis sonntag 13destrifft sichflensburgerhierammerseebiswiederfahrtenbootgeneration von weltmarktfhrerhelfen das foilenyacht digitalsich nike mitheftarchiv abo inhaltsverzeichnissecodeneue ausrstung panoramaactionder testwelt gesegeltaktuelle ausgabe newsletter16 der typischenflensburgcharme 16082017antifoulingbis sonntagabo heftinfo yacht27bootsportrtrostock und warnemndeeinesmit einersonntag 13 augustbei yacht onlinezeigensun odyssey 440bilder 15082017zuarbeitfoilen siekleines schmuckstckaberrevolutionmagazin heftinfo digitaleszur gastbeidas erste maldie welt37ostsee naturhafenonboardbilderbeharktenvergangenen wochenendeannehmlichkeiten einesopen 32innovativeder woche080720170208201736 karls kleinerblauwasser ein lebenbisschen wie weihnachtentrimarankrummin hat ihrender schleirobbebrudernachauf dennrv media10 traditionsklassenmeetingihren hafender karibikauf karlc65allebestellen heftmit vier sternenmarinayacht konntereportagen downloadtraditionsklassenmeeting ammersee 19062017zu neuenrevierbericht im pdfdownloadmagazin aktuelle ausgabeam wochenendedanneinen neuenstranderstmals ausgetragenennicht dieleben auf seemessensegeln siebisschenfrankreichdigitaleself 12mryachtenaboerhltlichschotenkrios umauf der hamburgerder aktuellen ausgabetechnik werkstattaufgewertet und mit6ihresindtypischengleich mehrere bootstypen1570s beim erstmalsfehler von chartercrewssee ich wrdefahrtenbootgeneration vonich wrdeweltmarktfhrer beneteau alsdie zweitwasserungelbe dieim test 0508201738letzte49variabilitt dieankerplatz erkundet wirdblack maggyvon chartercrewsversicherungsnews tvtippssteiger vlog 36reinke super 1070srobbe berking 12mrtf10 segeln sieschnj 70s beimcharternchartercrews teilmallorcasorgenschnstenzurcklang sind karinim test20einhandregatta rund fnen31vom jollenkreuzer gepaartyachtfotografkommt dieeine bilanzspeziellesind gleichwurdehat die11bootstestsflensburger frdefrde ihrevariabilitt2119062017 am vergangenenheftinfo digitales13082017 dreidas bootsportrt im13boote bootstests gebrauchtbootstestsdie welt gesegeltnikefoilen salonfhig zu24072017 derreisenews klassikernews versicherungsnewseinemvier sternenzweitwasserung derarbeiten70s beimthemen der aktuellenausgetragenen mediacupauf derdie extreme28072017 es istder trimaran tf10oderhat seinen opentop 16blogsschultzerhlmehrereyachtfotograf nicolosdownload reiseplanungobrevolution 29knappmeterbaukunst von damalsmeterklasse starkekrios um die182017 jetzt erhltlicheinem traditionellen dreieckskursgroessternen klassifiziertaufstiegshilfenschwesteretwaswird nike steiger0sind gleich mehrereneues beibootdas portrt imsegelreviere reportagenbeneteau oceanismediacup desaugust istdiesesdichtmassenverdientbesten bilderihren hafen weiterfehler vonvolvo ocean racedie ersten bilderdie in polenterminebeharkten sichverlngert fotosschimmel zurckbootsbauvlog 36soloseglerinteam brunelschiffregattanews reisenewsglobepinne 13082017seebietetweiter aufgewertetimmersucht doch kommtreiseforum16 dererste fotosmaggy 15082017bootstypen aufgegangen diemit denunsererpanorama sport ampweltglobe olympische spiele12mr europameisterschaftdrei tagewolfram heibeckolympische spiele allemit karlwindjammerfahrten erlebnismeileumbaukaribikist dasalleinrostockstellthatheft abonnieren digitalyacht 182017 jetztwie manfahrtenbootgenerationvergleichstest kompaktklasse 31fuvergleichpanorama regattanews reisenewswettfahrten aufleaguewerdenabonnieren yachtwettfahrten auf einemsegelaction auf derkarl nikedie top 16lineswartensport ampneues beiboot mitbereitsgegen pinne40 fugepaartwieder machenreiseplanung42malungewhnlich spannenden konzeptsviel losausgabe newsletter gewinnspiel10 traditionsklassenmeeting ammerseediesenike steigerhamburgergebrauchtbootstests das besonderedie reinke neueedel und elegantnchstenbayabo ausgabeder neuenbeiboot mit demneuesich crews auseineboot12mryachten trugentvtipps termine blogskauftfnfgibtfahrtabo inhaltsverzeichnisse kalenderbltterkamen zahlreiche klassikerbuntesyachttvnaturhafen mitvariabilitt die ihresgleichenauftaktmodellhochseeregattaein bisschen wiewelt deskleb und dichtmassenjeanneaueindrcke aus leshafengegen pinne 13082017mcconaghyvon weltmarktfhrer beneteaudenjrgen schultzerhl aufobenberichtlassendie yacht konntewochenende war32 fr diewarbei yachtdie kleinefactory china mcconaghyvon damals heranperformancecruiser flaggschiffwindjammerfahrtenoceanmacht sich nikeaus der deutschen23die genemit viel charmeneue schotenaus der schweiztrimaran tf10 solltf10 soll helfensich nikekarls kleiner bruderauenpostenpreisesalonfhig zu machenversicherungsnewsxxljolli mit deckssalonoder foilensegelentspanntehamburg46 im testracezum volvo oceangroeamp technik werkstattvon chartercrews teil10ist ein05072017 elfeinenhat nike steigerrefitblog12mr europameisterschaft ausbestellenfigaro 3konnte das auftaktmodell511 20072017ankerplatz20072017 die yacht46 imsofortcomfortina 46erlebnismeileheibeck hat seinenam vergangenendem zuknftighat seinenein neuestf10 sollbilderdreieckskurs zu messenreinke neuewirmit freundenvendeeindrcke vom zwlferfestnewsletter gewinnspieldeckssalon 29072017schweiz sindder hamburger auenalstervon den erstentesthansekleine marinatrugen aufburling45programmklassikernews versicherungsnewsam wochenende wareindrcke vom05082017segelaction aufamsterdamnrv aufbilder 15082017 ammedia cup tauschej 70sblackwar die extremesupermcconaghy factory chinaseinen open 32karl nike steigerauftaktmodell der nchstenneuen liniekarinauf der elbeschiefboote bootstestsolympische15082017 am wochenendeodysseyexklusivtestveranstaltungstipp groe segleroceanismachen 15082017umbau operationersten bilderneuen beneteauvende globebilder vonflensburg 05072017 elfwochenende kamen2hafen weiterbluesounddie erstesailing series segelactionmedienlandschaft auf jsailder flensburgerhat ihren hafenneuen beneteau oceaniskrumminhandwerkliche baukunst vonstarke eindrcke vomauf ihrer 39fustahlyachtder schweiz sindaussiebenlang beharktenauf jboote neue ausrstungchartercrewsum28nike ihrenfnen aufda esflaggschiff comfortina 46hanseyachts hanseklassikernewszurnico kraussklassische yachtenmagazin aktuelle25vier wettfahrtenjahre langausrstung panorama regattanewsmedienlandschaft aufrace starmarina in krumminspannenden konzepts exklusivendepdfdownloaddownloadeinem traditionellenexklusiv beizweitwasserungrasanter xxljollinrvmagazin heftarchivsport amp action33erhltlich themenkleines schmuckstck auf32alterschmuckstck auf usedomreportagen download reiseplanungsollkompaktklasse 31fuvergleichshelter bayaufgegangen die genetippsflensburger frde ihreklassiker zusammenyacht konnte dasungewhnlichhaikutterregatta windjammerfahrtenhaikutterregattadie handwerkliche baukunstbei derrobbe berkingpolendie yachteine auswahlmachensternen klassifiziert ein16082017 dievon denthemen derausrstungerneueswochenende war dierevierbericht imsunpinne 13082017 dreiimregattanewsbrunelpatientsegeln eindrcke ausspagerteaugustbisherrasanter xxljolli mit18der nchsten fahrtenbootgenerationsie schonyawlversicherungsnews tvtipps termine12mryachten trugen aufsie mitcup tauscheerkundetelbe die bestennews digitales magazinstar sailorsjetzt erhltlichyachtsuntieportrteinigetastatur gegen pinnevielzu messen klassikermagazin heftarchiv aboauftakt13 augustkarlsofort wiederyacht onlineweitereamericasextremedreikrummin haterstes magazin segelnhabenseries zur gastiibeneteau oceanis 511vergleichstestsun odysseytermine blogsbeneteauyacht classicteil 1ostsee naturhafen mitzu machen dietest 05082017wie dieerste fotos vomkalenderbltterwie man diemcconaghy factoryphaseaufgegangen diecnbmaggy12mrschweiz sind gleichdurcheinhandregatta rundhelfen dasliegttypischen fehlermit 80als erstes magazinoptikflensburg 05072017refitblog wochevergleichstest kompaktklassefastwirdstauraumshelterder flensburger frdelebenyacht 182017wrde dasheftinfo digitales magazinaction seemannschafttrautstartkielsonntagerlebnismeile und sailinghelfenvondie osmosedie meistendieserdas bootsportrt15082017 amgleichmit demder nchstennicht ganzjahresie nochdazuholzmagazin heftinfo16082017 die kleinegebrauchtbootstests34technikleben aufamericas cupsonntag 13lsstnach derbeimbuntes programm aufsegler und buntessegeln sie nochist frknnendem zuknftig dertraditionellen dreieckskursschweizheftinfo yacht abonnierenselbstmedienlandschaftfr jedermannihrer 39fustahlyachtheftarchiv abokonzepts exklusivdie gene vomsucht dochmeterklassenaturhafen mit vielwird dasjclassic news digitalesihntraditionsklassenmeetinghanse sail 11082017die erstenihresgleichen suchttraditionellen dreieckskurs zuwichtigstenpinneyacht digital aboersteonlinebluesound aus511 20072017 dietypischen fehler von05082017 edelgewinnspielspannende offsilverrudder die zweitwasserungbilder von derdas auftaktmodellsailingein lebenspannenden konzeptsstar sailors leagueschmuckstck auf24072017 der trimarannike steigerses ist einbootsforummehrere bootstypenhaikutterregatta windjammerfahrten erlebnismeilebevorvom exklusivtest12classic newswinschennrv media cupzweitest imrennendas foilenmussschnellden annehmlichkeitennunsteiger vlogkarlsder bluesound ausschonvende globe olympischeabonnierenauf diemeterklasse starke eindrckeschon 24072017 derschon 24072017spannendezwlferfest in flensburgzweitwasserung der blackflaggschiffusedomwerftwarnemndelangenfilmonboardbilder von jozefislandwie weihnachten frzwischenunsein neues beibootbesonderereinke supertest ampschon gesegelt erstegepaart mit dengehteinmalauf j 70svon jozefmit den annehmlichkeitenzauberpeterrund fnenesfertigtein kleines schmuckstckblogs alle newsdes nrvsportkarin und jrgendas foilen salonfhigwenn manweihnachtenkonnte dasaus derbestenfotos von denfotos vomzwlferfestreisenewsgetestetaktuellen ausgabebruder 28072017der trimaransailing seriesnews digitalesberkingihrer 39fustahlyacht krioskleinevier sternen klassifiziertannehmlichkeitenum sichkonstrukteurseinergleich mehreretauscheinhaltsverzeichnisse kalenderbltterauenalsternews segelreviere reportagenbesser03072017fotosnurseinenbaukunst vonwar diewrde das sofortstehtdeutschen medienlandschaft auf39fustahlyacht krios umglobe olympischemachtfu verlngertseinen openzurck aufseries segelaction aufdeutschensegelreviere reportagen downloadbekommtjozef kubica extremewasserletztenpolen gebautecup volvodamals heransailors league vendeausrstung neue ausrstungeiner variabilittnchsten fahrtenbootgenerationsegelactionauf einemhafen weiter aufgewertetzuknftigdolonneyachtenoff und onboardbilderspiele allefinale03082017vermeidbarenseinaus galerietourersclassflaggschiff comfortinaber dieteil 2blauwasserdownload reiseplanung reiseforumklassikernammersee 19062017 ammeistender elbetrimaran tf10newsletterklassifiziertdie topschultzerhl auf ihrerwiebaukunstocean race starden ersten trnsstarke41gegen die osmoseheftinfojollenkreuzer gepaartcomfortina 46 imsoll helfenneuchinawelt gesegelt eineerstmalserkundet wirdbootsportrt im pdfdownloadhamburg spannendereiseplanung reiseforumvon den arbeitenjrgenblogs allesailors leagueseries segelactionmacht dasabonnieren yacht digital15082017 wolframabo ausgabe bestellenohneseemannschaft testihre robbe berkingthemen ausgabe bestellenbluesound rasanteraufodyssey 440klassikernews versicherungsnews tvtippsihrportrt im pdfdownloadder typischen fehlertrailer40der deutschen medienlandschaftaufgegangenmittelmeerbeim erstmalsdas auftaktmodell derbeneteau als erstesoperation silverrudder dieausgetragenen mediacup des36ocean raceauf see ichberist esheftinfo yachtforumvon damalsseries29072017 in derelf50einhandregattaneue winschenendlichdochhttedeutschlandnorddeutschenbruder 28072017 es39fustahlyacht kriosviel charmeder schimmeldeutschen medienlandschaftmal wiederden mastbluesound aus dergegen dieweihnachten frmachen dietage lang beharktenseemannschaft test ampalle newskubicacup tausche tastaturaktuelle ausgabekleinerdie reinkekielerdie einhandregattanichttrifftsegelreviereauf usedombesondere boot bootsforumcrewsausrstung ausrstungstestsdas portrtlang sindedelheft abonnierencrews auszusammenden ersten24eines ungewhnlich spannendeninhaltsverzeichnisse kalenderbltter fotowettbewerbrace star sailorsfnenaktuelleum die weltlos in rostockbilder einesvomtop 16 der38 jahre lang39fustahlyachtmit vierklassiker eindrckevier40 fu verlngertbootelangesuchtvergangenenich wrde dasbeiboot mitmaggy 15082017 wolframchina mcconaghyklassischesoll helfen dasangstnordenmachen die erstenrasanterkubica extremesalonfhigosmosegelingtdigital aboyachtkonnte51trotzerstmals ausgetragenen mediacupamp technikjozefbootstypen aufgegangengroe seglerauf der hansedieaufsdie ihresgleichen17korrosionconductors bisboote neue19mit einer variabilittclassicbaldvon jozef kubicadetailself 12mryachten trugenderdeckssalonum die05072017 elf 12mryachtenrevierberichtnochaktuellenausgetragenen29drei tage langj classankerplatz erkundetpeter burlingkeineausgabe newsletterauf seecomfortinader markees isttest 05082017 edeleines ungewhnlichkriosgepaart mitaction seemannschaft testder deutschenconductorsberking 12mr12mryachtenmagazin segeln eindrckemehrere bootstypen aufgegangen35lesertippportrt imspannenden14patient teakdecksegelnheranneuenunterdie kleine marinatrnsbootstests gebrauchtbootstests dashilfezusammen um sichsiehanse 548auf 40 fuperformancecruiser flaggschiff comfortinagast in hamburgsind karinwrdenorwegenkomfortable28072017 essich diehimmelsind schnelldie zweitwasserung dertvtippspekingschimmeleineroceanis 511 20072017der revierberichtmit deckssalon 29072017einer variabilitt diezuknftig der ankerplatzuntie the linesexklusiv bei yachtjollenkreuzerstarmassivtf10 segelnbaycruiserungewhnlich spannendenjahrenerkundet wird nikeseinegutsuper 10aufgewertetmediacupoder foilen siekalenderbltter fotowettbewerbausgabe bestellen heftausrstung panoramaersten trnsder ankerplatzheibeckreportagenhanse sailoceanis 5114mediacup des nrvsailorshamburg spannende offschleikubica extreme sailinginserierendufourverlngertdigitales magazin aktuelleleague vende globeschmuckstckgfkklassikeramericas cup volvoihrenrund fnen aufmacht sichzahlreichereisenews klassikernews13082017 drei tage26neue hochseeregattader black maggy11082017 haikutterregatta windjammerfahrtensorgenfreisoabo heftinfojetztboot bootsforumder schweizklassiker eindrcke vomkleiner bruder 28072017gesegelt eineihrerfrdeneue bootewerauftaktmodell dertage langdie besten bilderbiga 270wochenendeviel charme 16082017bietenerstes magazineinem tagoperation silverrudderyacht an dietraditionsklassenmeeting ammerseefr die reinkeofffotowettbewerbjollenkreuzer gepaart mitden annehmlichkeiten einesauswahlzum volvosechscharmetestvideoblack maggy 15082017kataus lesdie einhandregatta rundveranstaltungstipp groeherstellertausche tastatur gegenextreme sailingfu verlngert fotosdas besondere boot38 jahreverlassenmit deckssalonklassifiziert ein kleineskaumjrgen schultzerhlaltenistaugenschmausdemkonzeptsxxljollivom exklusivtest derklassifiziert einder elbe dieweiterzu messeneindrcke voneuropameisterschafttvtipps termineist vielnoch odercharme 16082017 diemagazin segelngene vomkompaktklassevorwolframbordeauxsables dolonneeigener30keinnach obenbuntes programmfestgehaltenauf einem traditionellenregattanews reisenews klassikernewspanamaspiritaktuellfactoryelegant dazu mitunserer dehlyanews segelreviere

Longtail Keyword Density for Yacht.de

KeywordsOccurences
nike steiger vlog58
volvo ocean race14
der test im12
um die welt12
test im pdf-download12
extreme sailing series11
auf der elbe8
portrt im pdf-download8
das portrt im8
von chartercrews teil6
fehler von chartercrews6
es ist ein6
die yacht konnte6
typischen fehler von6
chartern die top6
steiger vlog 366
die welt gesegelt6
die top 166
top 16 der6
der typischen fehler6
16 der typischen6
jetzt erhltlich themen5
das besondere boot5
karl nike steiger5
themen ausgabe bestellen5
aus der deutschen5
beneteau oceanis 5115
sun odyssey 4405
erhltlich themen ausgabe5
heft abonnieren digital5
ausgabe bestellen heft5
bestellen heft abonnieren5
war die extreme4
die extreme sailing4
wochenende war die4
15082017 am wochenende4
bilder 15082017 am4
sailing series zur4
am wochenende war4
gast in hamburg4
von jozef kubica4
bilder von der4
onboard-bilder von jozef4
off- und onboard-bilder4
vergleichstest kompaktklasse 31-fu-vergleich4
hamburg spannende off-4
series zur gast4
nach der ersten4
wie man die4
patient teakdeck teil4
zurck an die4
segel-action auf der4
series segel-action auf4
sailing series segel-action4
der elbe die4
elbe die besten4
besten bilder 150820174
der schimmel zurck4
macht sich nike4
hat nike steiger4
die besten bilder4
kleb- und dichtmassen4
gegen die osmose4
der ankerplatz erkundet4
aufgegangen die gene4
die gene vom4
bootstypen aufgegangen die4
mehrere bootstypen aufgegangen4
gleich mehrere bootstypen4
gene vom jollenkreuzer4
vom jollenkreuzer gepaart4
den annehmlichkeiten eines4
annehmlichkeiten eines tourers4
mit den annehmlichkeiten4
gepaart mit den4
jollenkreuzer gepaart mit4
sind gleich mehrere4
schweiz sind gleich4
bluesound rasanter xxl-jolli4
rasanter xxl-jolli mit4
von damals heran4
baukunst von damals4
handwerkliche baukunst von4
xxl-jolli mit deckssalon4
mit deckssalon 290720174
aus der schweiz4
der schweiz sind4
bluesound aus der4
der bluesound aus4
29072017 in der4
vlog 36 karls4
36 karls kleiner4
neues beiboot mit4
beiboot mit dem4
ein neues beiboot4
schoten und ein4
winschen neue schoten4
mit dem zuknftig4
dem zuknftig der4
erkundet wird nike4
wird nike steiger4
ankerplatz erkundet wird4
tf10 segeln sie4
zuknftig der ankerplatz4
neue winschen neue4
reinke neue winschen4
28072017 es ist4
ist ein bisschen4
bruder 28072017 es4
kleiner bruder 280720174
karls kleiner bruder4
ein bisschen wie4
bisschen wie weihnachten4
die reinke neue4
fr die reinke4
weihnachten fr die4
wie weihnachten fr4
das erste mal4
trimaran tf10 soll4
frde ihre robbe4
ihre robbe berking4
flensburger frde ihre4
der flensburger frde4
auf der flensburger4
robbe berking 12-mr-4
berking 12-mr- europameisterschaft4
klassiker eindrcke vom4
yacht-fotograf nico krauss4
europameisterschaft aus galerie4
12-mr- europameisterschaft aus4
trugen auf der4
12-mr-yachten trugen auf4
les sables dolonne4
meterklasse starke eindrcke4
aus les sables4
eindrcke aus les4
segeln eindrcke aus4
starke eindrcke vom4
eindrcke vom zwlfer-fest4
elf 12-mr-yachten trugen4
05072017 elf 12-mr-yachten4
flensburg 05072017 elf4
zwlfer-fest in flensburg4
eindrcke vom 104
vom 10 traditionsklassen-meeting4
auf einem traditionellen4
einem traditionellen dreieckskurs4
wettfahrten auf einem4
vier wettfahrten auf4
tag in vier4
traditionellen dreieckskurs zu4
dreieckskurs zu messen4
revierbericht im pdf-download4
der revierbericht im4
bootsportrt im pdf-download4
das bootsportrt im4
sich an einem4
zusammen um sich4
19062017 am vergangenen4
ammersee 19062017 am4
traditionsklassen-meeting ammersee 190620174
10 traditionsklassen-meeting ammersee4
am vergangenen wochenende4
vergangenen wochenende kamen4
klassiker zusammen um4
zahlreiche klassiker zusammen4
kamen zahlreiche klassiker4
wochenende kamen zahlreiche4
magazin segeln eindrcke4
erstes magazin segeln4
zu machen die4
machen die ersten4
salonfhig zu machen4
foilen salonfhig zu4
das foilen salonfhig4
die ersten bilder4
ersten bilder eines4
spannenden konzepts exklusiv4
ungewhnlich spannenden konzepts4
eines ungewhnlich spannenden4
bilder eines ungewhnlich4
helfen das foilen4
soll helfen das4
foilen sie schon4
oder foilen sie4
noch oder foilen4
sie noch oder4
sie schon 240720174
schon 24072017 der4
tf10 soll helfen4
die handwerkliche baukunst4
der trimaran tf104
24072017 der trimaran4
konzepts exklusiv bei4
exklusiv bei yacht4
auftaktmodell der nchsten4
der nchsten fahrtenboot-generation4
das auftaktmodell der4
konnte das auftaktmodell4
yacht konnte das4
nchsten fahrtenboot-generation von4
fahrtenboot-generation von weltmarktfhrer4
als erstes magazin4
beneteau als erstes4
weltmarktfhrer beneteau als4
von weltmarktfhrer beneteau4
20072017 die yacht4
511 20072017 die4
erste fotos vom4
gesegelt erste fotos4
schon gesegelt erste4
bei yacht online4
fotos vom exklusivtest4
vom exklusivtest der4
oceanis 511 200720174
neuen beneteau oceanis4
der neuen beneteau4
exklusivtest der neuen4
segeln sie noch4
die in polen4
von den arbeiten4
fotos von den4
verlngert fotos von4
arbeiten und eindrcke4
eindrcke von den4
blauwasser ein leben4
den ersten trns4
von den ersten4
fu verlngert fotos4
40 fu verlngert4
die einhand-regatta rund4
fr die einhand-regatta4
32 fr die4
einhand-regatta rund fnen4
rund fnen auf4
yacht an die4
fnen auf 404
ein leben auf4
leben auf see4
lang sind karin4
jahre lang sind4
38 jahre lang4
karin und jrgen4
jrgen schultze-rhl auf4
auf ihrer 39-fu-stahlyacht4
schultze-rhl auf ihrer4
15082017 38 jahre4
machen 15082017 384
ich wrde das4
see ich wrde4
auf see ich4
wrde das sofort4
das sofort wieder4
wieder machen 150820174
sofort wieder machen4
open 32 fr4
seinen open 324
krummin hat ihren4
marina in krummin4
die kleine marina4
hat ihren hafen4
ihren hafen weiter4
mit vier sternen4
aufgewertet und mit4
hafen weiter aufgewertet4
16082017 die kleine4
charme 16082017 die4
sich nike mit4
magazin aktuelle ausgabe4
digitales magazin aktuelle4
ostsee naturhafen mit4
naturhafen mit viel4
viel charme 160820174
mit viel charme4
vier sternen klassifiziert4
sternen klassifiziert ein4
maggy 15082017 wolfram4
black maggy 150820174
der black maggy4
15082017 wolfram heibeck4
wolfram heibeck hat4
hat seinen open4
heibeck hat seinen4
zweitwasserung der black4
die zweitwasserung der4
kleines schmuckstck auf4
ein kleines schmuckstck4
klassifiziert ein kleines4
schmuckstck auf usedom4
umbau operation silverrudder4
silverrudder die zweitwasserung4
operation silverrudder die4
ihrer 39-fu-stahlyacht krios4
auf 40 fu4
beim erstmals ausgetragenen4
70s beim erstmals4
j 70s beim4
erstmals ausgetragenen media-cup4
ausgetragenen media-cup des4
nrv auf der4
des nrv auf4
media-cup des nrv4
auf j 70s4
medienlandschaft auf j4
beharkten sich crews4
lang beharkten sich4
tage lang beharkten4
sich crews aus4
crews aus der4
deutschen medienlandschaft auf4
der deutschen medienlandschaft4
auf der hamburger4
der hamburger auenalster4
variabilitt die ihresgleichen4
einer variabilitt die4
39-fu-stahlyacht krios um4
die ihresgleichen sucht4
ihresgleichen sucht doch4
polen gebaute yacht4
doch kommt die4
sucht doch kommt4
dazu mit einer4
elegant dazu mit4
comfortina 46 im4
flaggschiff comfortina 464
performance-cruiser flaggschiff comfortina4
46 im test4
im test 050820174
edel und elegant4
test 05082017 edel4
drei tage lang4
mit einer variabilitt4
11082017 haikutter-regatta windjammer-fahrten4
sail 11082017 haikutter-regatta4
hanse sail 110820174
haikutter-regatta windjammer-fahrten erlebnismeile4
erlebnismeile und sailing4
conductors bis sonntag4
sailing conductors bis4
der hanse sail4
auf der hanse4
welt gesegelt eine4
krios um die4
13082017 drei tage4
gesegelt eine bilanz4
segler und buntes4
programm auf der4
buntes programm auf4
bis sonntag 134
veranstaltungstipp groe segler4
media cup tausche4
nrv media cup4
cup tausche tastatur4
tausche tastatur gegen4
sonntag 13 august4
tastatur gegen pinne4
gegen pinne 130820174
rostock und warnemnde4
13 august ist4
pinne 13082017 drei4
ist viel los4
august ist viel4
los in rostock4
klassiker-news versicherungs-news tv-tipps3
versicherungs-news tv-tipps termine3
neue ausrstung panorama3
ausrstung panorama regatta-news3
reise-news klassiker-news versicherungs-news3
regatta-news reise-news klassiker-news3
panorama regatta-news reise-news3
neue boote bootstests3
gebrauchtbootstests das besondere3
besondere boot boots-forum3
ausrstung neue ausrstung3
bootstests gebrauchtbootstests das3
boote bootstests gebrauchtbootstests3
termine blogs alle3
blogs alle news3
boote neue ausrstung3
tv-tipps termine blogs3
zu messen klassiker3
abonnieren yacht digital3
neue ausrstung ausrstungs-tests3
yacht digital abo3
der aktuellen ausgabe3
themen der aktuellen3
yacht abonnieren yacht3
heft-info yacht abonnieren3
digital abo ausgabe3
abo ausgabe bestellen3
seemannschaft test amp3
test amp technik3
amp technik werkstatt3
action seemannschaft test3
amp action seemannschaft3
panorama sport amp3
sport amp action3
neue boote neue3
heft-info digitales magazin3
reinke super 103
abo heft-info yacht3
aktuelle ausgabe newsletter3
news digitales magazin3
classic news digitales3
abo inhaltsverzeichnisse kalenderbltter3
inhaltsverzeichnisse kalenderbltter fotowettbewerb3
ausgabe newsletter gewinnspiel3
zum volvo ocean3
182017 jetzt erhltlich3
jozef kubica extreme3
kubica extreme sailing3
yacht 182017 jetzt3
untie the lines3
mcconaghy factory china3
factory china mcconaghy3
heft-archiv abo inhaltsverzeichnisse3
magazin heft-archiv abo3
cup volvo ocean3
ocean race star3
race star sailors3
americas cup volvo3
download reiseplanung reise-forum3
segelreviere reportagen download3
reportagen download reiseplanung3
star sailors league3
sailors league vende3
spiele alle news3
magazin heft-info digitales3
digitales magazin heft-archiv3
olympische spiele alle3
globe olympische spiele3
league vende globe3
vende globe olympische3
news segelreviere reportagen3
nike steiger62
steiger vlog58
im pdf-download40
auf der30
americas cup17
fr die15
aus der15
von der14
volvo ocean14
die welt14
ocean race14
um die12
der test12
test im12
extreme sailing11
sailing series11
im test10
mit dem10
mit karl10
es ist10
oceanis 5119
mit den8
sich nike8
eindrcke vom8
16082017 die8
yacht classic8
die yacht8
geht es8
der elbe8
die reinke8
von den8
das portrt8
portrt im8
ausgabe bestellen8
bei der8
der neuen8
refit-blog woche8
ist die8
beneteau oceanis7
neue ausrstung7
sun odyssey7
dehlya 257
digitales magazin7
auf ihrer6
comfortina 466
welt gesegelt6
vlog 366
hat die6
nach der6
wie man6
es gibt6
machen die6
auf einem6
sie mit6
ein neues6
jahre lang6
besten bilder6
eindrcke von6
ist fr6
mit der6
macht sich6
den mast6
der hamburger6
einen neuen6
yacht konnte6
yacht online6
gibt es6
wenn man6
mit einer6
top 166
16 der6
der typischen6
teil 26
wie die6
im film6
nico krauss6
die top6
chartern die6
von chartercrews6
chartercrews teil6
ist ein6
neue boote6
alle news6
typischen fehler6
fehler von6
jetzt erhltlich5
erhltlich themen5
der deutschen5
zu neuen5
die besten5
tv-tipps termine5
amp technik5
das besondere5
bestellen heft5
heft abonnieren5
besondere boot5
themen ausgabe5
abonnieren digital5
kieler woche5
odyssey 4405
karl nike5
erkundet wird4
die osmose4
gegen die4
erste mal4
ankerplatz erkundet4
series segel-action4
der ankerplatz4
fr das4
ein augenschmaus4
da es4
das erste4
die meisten4
auf karl4
segel-action auf4
wird nike4
wird sie4
elbe die4
vor allem4
neues beiboot4
war die4
die extreme4
series zur4
hamburg spannende4
zur gast4
wochenende war4
am wochenende4
unserer dehlya4
mal wieder4
dem zuknftig4
bilder 150820174
beiboot mit4
15082017 am4
zuknftig der4
trifft sich4
hat nike4
der ersten4
der 354
shelter bay4
zurck auf4
der schimmel4
schimmel zurck4
ist das4
nike steigers4
teil 14
nicht die4
ber die4
auf den4
auf die4
baycruiser 264
sich nicht4
der yacht4
welt des4
biga 2704
sind schnell4
ist es4
die arbeit4
mit freunden4
die neue4
nike ihren4
man die4
patient teakdeck4
vergleichstest kompaktklasse4
der erste4
teakdeck teil4
kompaktklasse 31-fu-vergleich4
zu verlassen4
sie sich4
tf10 soll4
noch einmal4
mit 804
eine auswahl4
aus galerie4
12-mr- europameisterschaft4
europameisterschaft aus4
yacht-fotograf nico4
j class4
traditionsklassen-meeting ammersee4
ammersee 190620174
10 traditionsklassen-meeting4
vom 104
klassiker eindrcke4
berking 12-mr-4
robbe berking4
flensburg 050720174
05072017 elf4
vom zwlfer-fest4
starke eindrcke4
sables dolonne4
meterklasse starke4
elf 12-mr-yachten4
12-mr-yachten trugen4
frde ihre4
ihre robbe4
flensburger frde4
der flensburger4
trugen auf4
19062017 am4
am vergangenen4
revolution 294
der schlei4
fr jedermann4
der marke4
nach oben4
wird das4
das bootsportrt4
bootsportrt im4
der revierbericht4
revierbericht im4
wir haben4
zwei jahre4
fr eine4
zu messen4
dreieckskurs zu4
zahlreiche klassiker4
klassiker zusammen4
kamen zahlreiche4
wochenende kamen4
vergangenen wochenende4
zusammen um4
um sich4
einem traditionellen4
traditionellen dreieckskurs4
wettfahrten auf4
vier wettfahrten4
einem tag4
les sables4
aus les4
soll helfen4
helfen das4
trimaran tf104
der trimaran4
schon 240720174
24072017 der4
das foilen4
foilen salonfhig4
ersten bilder4
bilder eines4
die ersten4
zu machen4
salonfhig zu4
sie schon4
foilen sie4
bilder von4
hanseyachts hanse4
die erste4
jozef kubica4
onboard-bilder von4
von jozef4
neuen linie4
die werft4
noch oder4
oder foilen4
sie noch4
segeln sie4
tf10 segeln4
eines ungewhnlich4
ungewhnlich spannenden4
fahrtenboot-generation von4
von weltmarktfhrer4
nchsten fahrtenboot-generation4
der nchsten4
das auftaktmodell4
auftaktmodell der4
weltmarktfhrer beneteau4
beneteau als4
segeln eindrcke4
eindrcke aus4
magazin segeln4
erstes magazin4
als erstes4
konnte das4
20072017 die4
bei yacht4
schon gesegelt4
exklusiv bei4
konzepts exklusiv4
spannenden konzepts4
gesegelt erste4
erste fotos4
neuen beneteau4
511 200720174
exklusivtest der4
vom exklusivtest4
fotos vom4
spannende off-4
eines tourers4
ein leben4
blauwasser ein4
ersten trns4
den ersten4
leben auf4
neue schoten4
das sofort4
wrde das4
ich wrde4
see ich4
den arbeiten4
fotos von4
einhand-regatta rund4
die einhand-regatta4
32 fr4
open 324
rund fnen4
fnen auf4
verlngert fotos4
fu verlngert4
40 fu4
auf 404
sofort wieder4
wieder machen4
buntes programm4
groe segler4
veranstaltungstipp groe4
eine bilanz4
programm auf4
der hanse4
haikutter-regatta windjammer-fahrten4
11082017 haikutter-regatta4
sail 110820174
hanse sail4
gesegelt eine4
krios um4
lang sind4
38 jahre4
15082017 384
machen 150820174
sind karin4
jrgen schultze-rhl4
39-fu-stahlyacht krios4
ihrer 39-fu-stahlyacht4
schultze-rhl auf4
seinen open4
hat seinen4
die kleine4
charme 160820174
viel charme4
mit viel4
kleine marina4
krummin hat4
weiter aufgewertet4
hafen weiter4
ihren hafen4
hat ihren4
naturhafen mit4
ostsee naturhafen4
aktuelle ausgabe4
magazin aktuelle4
classic news4
vende globe4
sich die4
klassische yachten4
macht das4
ganz allein4
nicht ganz4
nike mit4
mit vier4
vier sternen4
zweitwasserung der4
die zweitwasserung4
silverrudder die4
operation silverrudder4
der black4
black maggy4
heibeck hat4
wolfram heibeck4
15082017 wolfram4
maggy 150820174
umbau operation4
der woche4
kleines schmuckstck4
ein kleines4
klassifiziert ein4
sternen klassifiziert4
schmuckstck auf4
auf usedom4
im norden4
september die4
neue hochseeregatta4
windjammer-fahrten erlebnismeile4
auf see4
rasanter xxl-jolli4
xxl-jolli mit4
bluesound rasanter4
damals heran4
von damals4
mit deckssalon4
deckssalon 290720174
schweiz sind4
der schweiz4
bluesound aus4
der bluesound4
baukunst von4
handwerkliche baukunst4
ihresgleichen sucht4
die ihresgleichen4
variabilitt die4
einer variabilitt4
sucht doch4
doch kommt4
die handwerkliche4
gebaute yacht4
polen gebaute4
kommt die4
sind gleich4
gleich mehrere4
ein bisschen4
28072017 es4
bruder 280720174
kleiner bruder4
bisschen wie4
wie weihnachten4
winschen neue4
neue winschen4
reinke neue4
weihnachten fr4
karls kleiner4
36 karls4
die gene4
sailing conductors4
bootstypen aufgegangen4
mehrere bootstypen4
gene vom4
vom jollenkreuzer4
annehmlichkeiten eines4
den annehmlichkeiten4
gepaart mit4
jollenkreuzer gepaart4
dazu mit4
aufgegangen die4
13082017 drei4
pinne 130820174
gegen pinne4
tastatur gegen4
drei tage4
tage lang4
sich crews4
beharkten sich4
lang beharkten4
tausche tastatur4
media cup4
sonntag 134
bis sonntag4
elegant dazu4
conductors bis4
13 august4
august ist4
nrv media4
viel los4
ist viel4
crews aus4
cup tausche4
deutschen medienlandschaft4
ausgetragenen media-cup4
erstmals ausgetragenen4
beim erstmals4
media-cup des4
05082017 edel4
performance-cruiser flaggschiff4
hamburger auenalster4
nrv auf4
des nrv4
flaggschiff comfortina4
70s beim4
46 im4
auf j4
j 70s4
medienlandschaft auf4
test 050820174
technik werkstatt3
boote neue3
panorama regatta-news3
messen klassiker3
ausrstung panorama3
regatta-news reise-news3
klassiker-news versicherungs-news3
bootstests gebrauchtbootstests3
gebrauchtbootstests das3
boot boots-forum3
ausrstung neue3
boote bootstests3
blogs alle3
test amp3
versicherungs-news tv-tipps3
termine blogs3
reise-news klassiker-news3
digital abo3
heft-info yacht3
peter burling3
team brunel3
aktuellen ausgabe3
der aktuellen3
themen der3
abo heft-info3
ausrstung ausrstungs-tests3
yacht abonnieren3
sport amp3
amp action3
action seemannschaft3
panorama sport3
abo ausgabe3
abonnieren yacht3
yacht digital3
seemannschaft test3
inhaltsverzeichnisse kalenderbltter3
ausgabe newsletter3
newsletter gewinnspiel3
mcconaghy factory3
factory china3
china mcconaghy3
kalenderbltter fotowettbewerb3
news digitales3
zum volvo3
der karibik3
reinke super3
yacht 1820173
182017 jetzt3
super 103
hanse 5483
kubica extreme3
figaro 33
abo inhaltsverzeichnisse3
heft-archiv abo3
cup volvo3
race star3
star sailors3
reiseplanung reise-forum3
download reiseplanung3
segelreviere reportagen3
reportagen download3
sailors league3
league vende3
heft-info digitales3
magazin heft-archiv3
magazin heft-info3
spiele alle3
globe olympische3
olympische spiele3
news segelreviere3
die280
der273
mit109
nike104
auf102
im96
das92
von76
fr75
den68
sich66
ein64
ist64
es62
steiger62
yacht60
vlog60
aus54
zu52
sie42
pdf-download40
eine38
zum34
nach32
vom32
neue31
vor30
karl30
hat30
segeln28
erste28
um28
neuen28
nicht28
test28
wieder26
des26
026
wird24
am24
wie24
cup23
sind22
noch22
bei22
als22
bilder20
zurck20
doch20
klassiker19
woche19
ersten18
beneteau18
man18
einem18
bis18
welt18
eindrcke18
dem17
americas17
sailing17
zur16
jahren16
viel16
einen16
ausgabe15
ber15
jetzt15
ocean15
wir14
news14
schon14
mehr14
auch14
wochenende14
geht14
volvo14
gegen14
race14
oder14
beim14
gibt14
teil14
magazin14
114
classic13
alle13
reinke13
einer12
muss12
durch12
zwei12
mal12
eines12
lang12
machen12
so12
series12
ihren12
macht12
212
sein12
nur12
yachten11
themen11
ausrstung11
hanse11
extreme11
oceanis11
dehlya11
hamburg11
wenn10
310
unter10
haben10
ganz10
ihr10
kommt10
vier10
410
ihre10
jahre10
endlich10
kann10
amp10
510
wurde10
gut10
abo10
statt10
aber10
allein10
deutschen10
gesegelt10
boote10
boot9
69
kiel9
regatta9
79
refit-blog8
online8
galerie8
kein8
tf108
lange8
drei8
fotos8
chartercrews8
bluesound8
ins8
konnte8
portrt8
88
elbe8
da8
hafen8
marina8
foilen8
teakdeck8
er8
war8
karls8
besondere8
bietet8
wasser8
bestellen8
leben8
segler8
j8
seiner8
digital8
exklusiv8
sechs8
segelt8
team8
bisher8
abonnieren8
dann8
aktuelle8
sieben8
dazu8
fehler8
nrv8
blauwasser7
97
werft7
panama7
107
sun7
besten7
digitales7
mcconaghy7
odyssey7
brunel7
technik7
neues7
heft7
jeanneau7
seemannschaft7
117
kleiner6
126
jollenkreuzer6
136
mehrere6
comfortina6
flaggschiff6
top6
hamburger6
chartern6
146
typischen6
156
166
trifft6
starke6
erstes6
zusammen6
lassen6
ohne6
nchsten6
050720176
zeit6
freunden6
176
186
jeden6
linie6
zeigt6
krauss6
196
getestet6
020820176
seine6
spannende6
206
revier6
immer6
sorgenfrei6
deutlich6
bieten6
zahlreiche6
dieser6
vergleichstest6
film6
trn6
knnen6
schimmel6
groen6
verlassen6
viele6
hier6
hilfe6
holz6
karibik6
nico6
einmal6
osmose6
216
steht6
mast6
226
erkundet6
groes6
nun6
werden6
weiter6
operation6
black6
ihrer6
trns6
arbeiten6
seinen6
kleine6
gelingt6
spannenden6
236
panorama6
heft-info6
deutsche6
246
256
rund6
frde6
266
klassische6
tage6
crews6
warnemnde6
los6
cnb5
factory5
ostsee5
fast5
275
erhltlich5
league5
285
295
peter5
termine5
tv-tipps5
burling5
bootsportrt5
code5
kieler5
werkstatt5
newsletter5
europameisterschaft5
deutschland5
030820174
304
uns4
download4
frankreich4
gebaute4
hanseyachts4
segelreviere4
himmel4
kubica4
segel-action4
handwerkliche4
vende4
sailors4
gast4
jozef4
onboard-bilder4
off-4
reise4
trimaran4
sables4
les4
weltmarktfhrer4
dolonne4
reise-news4
zwischen4
regatta-news4
langenargen4
fahrtenboot-generation4
auftaktmodell4
salonfhig4
helfen4
soll4
ungewhnlich4
konzepts4
314
exklusivtest4
blogs4
globe4
inserieren4
arbeit4
korrosion4
heran4
motor4
324
ausgetragenen4
media-cup4
finale4
alter4
beharkten4
zeigen4
trailer4
patient4
schwester4
entspannte4
august4
letzten4
auenalster4
334
bootstypen4
bord4
344
damit4
ganzen4
schiff4
baukunst4
damals4
unknown4
354
364
meisten4
lsst4
374
classics4
selbst4
letzte4
384
zauber4
meterklasse4
conductors4
schlei4
hai4
sonntag4
yawl4
ii4
spirit4
elegant4
variabilitt4
ihn4
startet4
komplett4
innovative4
jedermann4
394
spezielle4
medienlandschaft4
revolution4
fertigt4
kat4
kos4
sache4
404
charter4
island4
050820174
norwegen4
amsterdam4
lnger4
antifouling4
edel4
tauwerktest4
030720174
hersteller4
bornholm4
bericht4
revierbericht4
auenposten4
marke4
meter4
sucht4
auswahl4
erlebnismeile4
wichtigsten4
schnsten4
festgehalten4
erstmals4
yacht-fotograf4
polen4
12-mr-4
elf4
flensburg4
zwlfer-fest4
12-mr-yachten4
trugen4
berking4
robbe4
flensburger4
class4
traditionsklassen-meeting4
langen4
tipps4
414
details4
bereits4
oben4
c654
bavaria4
messen4
dreieckskurs4
kamen4
vergangenen4
ammersee4
ihresgleichen4
tag4
traditionellen4
wettfahrten4
dichtmassen4
seit4
steigers4
eins4
schock4
media4
umbau4
haikutter-regatta4
31-fu-vergleich4
kompaktklasse4
fnf4
080720174
silverrudder4
zweitwasserung4
einige4
vermeidbaren4
alles4
ende4
heibeck4
wolfram4
kauft4
schweiz4
maggy4
tausche4
lieber4
kleb-4
biga4
etwas4
start4
trailerbar4
komfortable4
dieses4
pinne4
hochseeregatta4
augenschmaus4
september4
schnell4
bevor4
tastatur4
ob4
massiv4
erfllen4
norden4
preise4
phase4
warten4
open4
424
winschen4
veranstaltungstipp4
weihnachten4
groe4
schoten4
bilanz4
ankerplatz4
zuknftig4
krios4
beiboot4
bisschen4
434
gepaart4
sail4
gene4
aufgegangen4
annehmlichkeiten4
tourers4
bruder4
buntes4
programm4
39-fu-stahlyacht4
444
fu4
verlngert4
rostock4
performance-cruiser4
454
fnen4
schn4
einhand-regatta4
htte4
see4
ich4
kaum4
ihrem4
jrgen4
schultze-rhl4
karin4
segel4
wrde4
sofort4
gleich4
usedom4
464
verdient4
auftakt4
rasanter4
bekommt4
besser4
traut4
segeltrn4
naturhafen4
sehr4
xxl-jolli4
norddeutschen4
sorgen4
bald4
charme4
angst4
optik4
menge4
trotz4
mapfre4
keine4
aller4
baycruiser4
werk4
rennen4
eigener4
schief4
windjammer-fahrten4
ums4
aufstiegshilfen4
gewonnen4
aufs4
nikes4
474
klassifiziert4
484
unserer4
neu4
bay4
kleines4
liegt4
schmuckstck4
knapp4
strand4
diesen4
70s4
aufgewertet4
sternen4
allem4
494
deckssalon4
fahrt4
wer4
dennoch4
diese4
alten4
krummin4
stellt4
shelter4
kalenderbltter3
konstrukteur3
gewinnspiel3
fotowettbewerb3
stauraum3
bootsbau3
mittelmeer3
aktuellen3
super3
forum3
spagerte3
gfk-klassiker3
reisebericht3
bordeaux3
lines3
reiseplanung3
peking3
untie3
soloseglerin3
action3
reise-forum3
503
aktuell3
figaro3
gebrauchtbootstests3
versicherungs-news3
bootstests3
boots-forum3
klassiker-news3
reportagen3
ausrstungs-tests3
star3
sport3
513
lesertipp3
klassikern3
testvideo3
kontakt3
weitere3
heft-archiv3
probefahrt3
china3
mallorca3
olympische3
yacht-tv3
spiele3
marten3
dufour3
yachts3
inhaltsverzeichnisse3

What are the nameservers for yacht.de?

Yacht.de Domain Nameserver Information

HostIP AddressCountry
ns1.adns2.de 217.31.82.10Germany Germany
ns2.adns2.de 62.116.145.206Germany Germany

Yacht.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yacht.de is a scam?