Yacht.de  |  YACHT online - Europas grösstes Segelmagazin im Netz | YACHT.DE
Low trust score  | 
Yacht Magazin

Yacht.de Website Information

Website Ranks & Scores for Yacht.de

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:97,920
Majestic Rank Majestic Rank:133,196
Domain Authority Domain Authority:65%
DMOZ DMOZ Listing:No

Whois information for yacht.de

Full Whois Lookup for Yacht.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Yacht.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html

Domain: yacht.de
Nserver: ns1.adns2.de
Nserver: ns2.adns2.de
Status: connect
Changed: 2007-02-01T13:48:32+01:00

Type: ROLE
Name: Hostmaster Hostweb
Organisation: Hostserver GmbH
Address: www.hostweb.de
Address: Biegenstr.20
PostalCode: 35037
City: Marburg
CountryCode: DE
Phone: +49.6421.924160
Fax: +49.6421.924165
Email: Login to show email

Type: ROLE
Name: Hostmaster Hostweb
Organisation: Hostserver GmbH
Address: www.hostweb.de
Address: Biegenstr.20
PostalCode: 35037
City: Marburg
CountryCode: DE
Phone: +49.6421.924160
Fax: +49.6421.924165
Email: Login to show email

Who hosts Yacht.de?

Yacht.de is hosted by teuto.net Netzdienste GmbH in Nordrhein-westfalen, Bielefeld, Germany, 33602.
Yacht.de has an IP Address of and a hostname of and runs nginx/0.7.65 web server.

Yacht.de Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:teuto.net Netzdienste GmbH
Hosted Country:GermanyDE
Location Latitude:52.0333
Location Longitude:8.53333
Webserver Software:nginx/0.7.65

HTTP Header Analysis for Yacht.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/0.7.65
Date: Mon, 13 Jul 2015 22:44:06 GMT
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.3.10-1ubuntu3.19
Cache-Control: max-age=0
Expires: Mon, 13 Jul 2015 22:42:36 GMT
X-Varnish: 2051535530 2051532750
Age: 88
Via: 1.1 varnish
Content-Encoding: gzip

Need to find out who hosts Yacht.de?

Yacht.de Free SEO Report

Website Inpage Analysis for Yacht.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yacht.de

noch oder foilentastatur gegenmit deronboardbilder vonfestgehaltenmachen 15082017 3803072017offchartercrews teilwettfahrtenerstes magazinmediacupsoampraceeindrcke ausbaldvom jollenkreuzer gepaartausgabe newsletterbis sonntagist viel losneue winschen neue15082017 38 jahredeutlichihre robbenorddeutschennchsten fahrtenbootgeneration vondas bootsportrtdigitalreisenews klassikernewsdie top 16altencharme 16082017sich nike13erste fotos vomwelt gesegeltwenn10 traditionsklassenmeetingbestellenvom jollenkreuzersofort wieder machenbunteseindrcke vom 10ganzflaggschiff comfortina 4605082017den annehmlichkeitenviel los13082017 drei tagetopumbauvon damals heran3716082017 die2cup tausche tastaturbestellen heftder ankerplatzedel16082017 die kleinedie werftauftaktmodell der nchstenwirdkonzeptsneue schotenistsegelactionschonihrebeiboot mit demjrgenkleinerhierbeim erstmals ausgetragenennchstenbootstypen26vende globejollenkreuzerder hamburger auenalstermediazuobenprogramm aufreinke neue winschennews digitalesaus der deutschentagdichtmassensailing series zur45wolfram heibecktrifft sichthemen derichsalonfhigheftinfo digitaleszweitwasserung derverlngertpinne 13082017leben aufder schweizvom zwlferfestmagazin heftinfokarlfr jedermannelf 12mryachtenbeharkten sichder hanse sailbootsportrtwar die extremelang sindcrews aus derder black maggyoceanis 511 20072017jeanneauzeigenmit denseitnike ihren20072017 die yachtbesten bilder 15082017veranstaltungstipperstesheftdas sofort wiederyacht 182017 jetztheftinfo digitales magazinselbstist eswarnemndeauf karlkleb und dichtmassenchartermussmalyachtfotograf nicocomfortinabeibootmagazin heftarchivdes nrv10 traditionsklassenmeeting ammerseeerstmals ausgetragenen mediacupfnen aufdie gene vomfrneue ausrstungsegelreviere reportagenfotosbei yachtpolen gebaute yachtihrschon gesegelt4hafen weiterislandvariabilitt diesilverrudder dieglobe olympischefoilenmagazin heftinfo digitalessegeln eindrckezeigtaus galeriebluesound ausbaukunst von damalsinnovativegehtstartsalonfhig zuauf 40fahrtenbootgenerationdie arbeitammersee 19062017teakdeckumbau operationich wrdetrailermal wiedersun odysseyzur gasthafenkleb02082017exklusivtestsonntag 13 augustflensburgoderneue winschenbei yacht onlinepanamablogs alle newsmehrere bootstypen aufgegangenregattanews reisenewsnrv auf derstatt0macht dasneues beiboot mitrevolutioneinhandregatta rundkleines schmuckstck aufclassicsyacht digitalrasanterfnenvon jozefmengemittelmeerexklusiv beioperationdeutschenbootstypen aufgegangenostseebekommtwiedersailorsvier wettfahrtenkorrosionabergesegeltkarinschocksail05072017 elf 12mryachtenschon 240720171739messen klassikerbuntes programmwurdenaturhafenflaggschiffeineseries segelactiontrugen auf derwrde das sofortsee ich wrdehelfenzu verlassendufourtourershamburgnoch oderneue boote bootstestsboote neuegegen die osmoseein kleines19viel charme 16082017silverrudder die zweitwasserungmagazin aktuelle ausgabe182017 jetzt20072017 diestartetbietenoptikkleine marinastarke eindrcke vomreiseherstellerwieder machen 15082017eindrcketf10 segeln siebootsportrt imbaycruiserkleiner bruder 28072017weiter aufgewertetauf einem16 der typischenteamfublackheftarchiv abokaum05072017digitalesausgetragenen mediacup desolympische spiele alleaufgewertetseries zur gastodyssey 440bisdie ersteteakdeck teilnach der erstentrnsesnach derhamburger auenalsterzahlreichemarina in krumminseinen openbiga 270sofort wiedergetestetsind gleich mehrereseemannschaftzuknftig39fustahlyachtbisschen wiewochevon weltmarktfhreryachtfotograf nico kraussbilder einesgfkklassikerwarbeim erstmalsveranstaltungstipp groe seglerbootstests gebrauchtbootstests15082017 wolframzuknftig der ankerplatzeinsaktuelle ausgabeabo heftinfo yachtsteiger vlogrobbesoll helfen dasden annehmlichkeiten eines14ausrstung panorama regattanewsausgabe bestellenblack maggytrautperformancecruiserals erstes magazin38 jahre langtrugen aufabo heftinfoopenkrummin hat ihrenerkundetvorsorgenbilder vonreisenews klassikernews versicherungsnews35polen31klassiker eindrckeeuropameisterschaft ausdieseszu messen klassikerkanngast in hamburgkarls12mrmit vier sternendas portrtwasserbluesound rasanterfrde ihre robbenike mitvon weltmarktfhrer beneteau27doch kommtreiseforumaktuellevieleonlinesteigersmehrereweihnachten frconductors bises ist einbordauf dender nchsten fahrtenbootgenerationendlichsail 11082017der markesailing conductors bisblogs alleabonnieren digitaldie toplesertippauf der hanse32 fr dieabomit freundenfrdecharme 16082017 dieschweiz sind gleichkomplettlieberreinke super 10bavariasail 11082017 haikutterregattatest im pdfdownloadvolvo ocean2342verdientsegelnhabengleich mehrerewie weihnachtenhaikutterregatta windjammerfahrten erlebnismeileich wrde das47der elbemachenaufgegangen die geneersten bilderpanoramaxxljollitastatur gegen pinneflensburg 05072017 elfelfwindjammerfahrten erlebnismeileerkundet wirdversicherungsnews tvtipps terminerund fnen aufgroe seglerdiese21bluesoundsie sichtvtippscharternder erstepinne 13082017 dreieinem traditionellen dreieckskursknapptauwerktestaktuellen ausgabezusammen um sichhanse saildetailsnike steiger vlogder erstenmastnews segelrevierekeinwie man die36 karls kleinertrailerbar19062017 amam vergangenen wochenendesailors league vende11082017 haikutterregatta windjammerfahrtenelbebesondere bootyacht13082017 dreikrummin hatsuperhat nike steigerdeutschen medienlandschaftwinschen neue schotendamitbornholmsie nochfoilen sie schonexklusivtest der neuenausstelltvierbaukunst vonkubica25bildermanbei derdanndie besten51trifftdie reinkehat seinenheibeck hat seinenbootezurck an dievolvoboot bootsforumphaseangstelegant dazu mitflensburger frdeamp action seemannschaftsiebenlinesdie yachtmeterklasseschmuckstck aufihremmagazin segeln eindrckemit deckssalon 29072017auf 40 fufr diederportrt im pdfdownloadtippsweihnachtenheranseptember dierostock und warnemnderobbe berking 12mrseinen open 32stehtdes nrv auf3da esgleich mehrere bootstypenleagueauf die28bis sonntag 13deckssalon 29072017hat ihren hafenletztentrimaran tf10 soll15082017 38zahlreiche klassikerarbeit8karl nike steigerhandwerkliche baukunstoperation silverrudder diegewonnenvom 10schwesterelbe dieimmerspannenden konzepts exklusivwird sieprogramm auf dersilverrudderwerftmachen die erstenim pdfdownloadihrender ankerplatz erkundetsechsrund fnenberking511 20072017 dieyacht konnteweltmarktfhrer beneteau alshandwerklichefr einebayamgibtman diedas bootsportrt imbootsbaumaggy 1508201713 augustfinaleklassikernewshelfen das foilenstarvon chartercrewsflensburger frde ihretermine blogs alledamalsdie meistenfilmihre robbe berkingseries zur15082017 wolfram heibeckzurerdie zweitwasserungstar sailors leagueaugust ist vielpekingabonniereneinhandregatta rund fnenabonnieren yacht19062017 am vergangenenabo inhaltsverzeichnissefnen auf 40spannende offschmuckstck auf usedomauf ihrer 39fustahlyachtmehrere bootstypenmit vierinhaltsverzeichnissebeneteau alsbilder 15082017 amkompaktklassebordeauxbootsforumeine auswahlauf j 70sankerplatz erkundetkraussfrankreichneuen liniemedienlandschaftgene vom jollenkreuzersteiger vlog 36hattechnik werkstattrevierbericht imperformancecruiser flaggschiff comfortinakonzepts exklusivgeht esder wochebilder eines ungewhnlichmallorcadie reinke neueheftarchiv abo inhaltsverzeichnissestrandschnellam wochenende warklassische yachtengegentop 16 dersuper 10kommtversicherungsnews tvtippshat seinen opennike steigersvariabilitt die ihresgleichensind schnellder neuen beneteauvlog 36 karlsliegtgepaart mitihren hafenyacht classicunknown03082017classic news digitalesauftaktmodell dergepaart mit dennordenzwei jahreneuen beneteauwird nikedie handwerkliche baukunstonboardbildermeistenauf der elbe40einer variabilitt diepolen gebautekubica extreme sailing70s beimglobenicovomdigitales magazin aktuelleteildeutschlandhimmeleines tourersgibt esfnfder yachtder trimaran tf10seetesthanse sail 11082017untie the lineszumhandwerkliche baukunst vonist dieneuenkomfortablechartern diekamen zahlreicheclassic newsclassichaikutterregatta windjammerfahrtenumtypischen fehler vonjahredenschon 24072017 derihnmacht sich nikeinserierenzusammen umden ersten trnstf10 sollbootstests gebrauchtbootstests daspanorama regattanewssich dieantifoulingallemgeneneuen beneteau oceanistestvideoneuegutnungebaute yachtfu verlngertrevolution 29rundnrv aufopen 32 frnewslettertf10 segelnvier wettfahrten aufvergangenenkrios um dieschweiz sindlngertvtipps terminearbeiten28072017 esrennenzum volvobruder 28072017factorychinawie weihnachten frberking 12mr europameisterschaftwochenende kamen zahlreicheklassikerungewhnlichuntiegroesseries segelaction aufauf seedie yacht konntelebenkompaktklasse 31fuvergleichnewsletter gewinnspieleineneindrcke aus leswelt gesegelt einemaggy 15082017 wolframnicht ganzvlogein bisschenmapfreauf derdennochfoilen siebootstestsdolonneconductorsist dastraditionsklassenmeeting ammersee 19062017meterklasse starke eindrckezahlreiche klassiker zusammender flensburger frdekonzepts exklusiv beijollenkreuzer gepaarttermineaugenschmauscup volvonoch einmalgebrauchtbootstestsneuinsklassifiziertwelt desyacht abonnierendie ihresgleichen suchtyacht onlinerasanter xxljollihanseyachtskrumminj 70s beimunsreinke supererste malerstes magazin segelnbuntes programm aufsich crews auskleiner bruderseinennach oben5cnbist vielseinefotos von densie noch oderchartercrewsauf der hamburger511 20072017spiele alle newsnicht diejrgen schultzerhl auf70szu machen diebestellen heft abonnierenolympische spieledownload reiseplanung reiseforumvon den arbeitenpatientder deutschen medienlandschaftweroff und onboardbildersportyacht abonnieren yachtaufgewertet und mitdiesenvon chartercrews teilklassiker zusammen umwichtigstenrobbe berkingcodecharmekarl nikezweitwasserungklassiker eindrcke vomaugustmartenum sichzum volvo oceannico kraussden mastausrstungstests16exklusiv bei yachtklassikernews versicherungsnewseines ungewhnlich spannendenbootsportrt im pdfdownloadtf10soloseglerindas auftaktmodellleague vende globe40 fu verlngertim testals erstesdasdie zweitwasserung derwettfahrten auf einemdurchalleumbau operation silverrudderder trimaranmarkespagerteersteder schweiz sindrefitblogstauraumexklusivcomfortina 46 imoder foilen sievlog 36ihren hafen weitergene vomgebauteseemannschaft test ampmedia cup tauscheyacht konnte dasfr die einhandregattadas sofortblogsdownload reiseplanungeines ungewhnlichalterimteil 2wietrotzeuropameisterschaft aus galeriesternen klassifiziertammersee 19062017 amgegen diegesegelt eine bilanzbilder 15082017yachttvdie osmose05082017 edel182017 jetzt erhltlichtrngebrauchtbootstests das besonderekontaktamericassablessegeltrnfreundenerfllenreportagen download reiseplanungfehler39fustahlyacht krios ummassivsegeln siedrei tage langbisschen wie weihnachtender typischen fehleramp actionaufgegangen dieannehmlichkeiten eines tourersein lebenkonnte dasyacht 182017nrv media cupfotos vom exklusivtestdasich crewsdoch kommt diebruderaktuellenvor allemder revierbericht imjozef kubica extremesofortwar dieheftinfo yacht abonnierenklassischeganz alleindochdehlya 25haikutterregattakrios umneues beibootsieportrtdrei tageodysseyrefitblog wochenews digitales magazinyachtfotografder schimmel zurckauftaktmodellentspanntebeharkten sich crewsdamals heranaus der schweizhanseyachts hanseoperation silverrudderaus les16 derschief22von damalserste fotosforum1vende globe olympischehelfen dasbevordazu mitschimmelregattanewsjetzt erhltlich20vier sternen klassifiziertles sableskleines schmuckstckungewhnlich spannenden konzeptseindrcke vom zwlferfestregattaschultzerhl auf32vier sternentop 16im nordentraditionsklassenmeetingtage langkielerreinke neuekieler wochetest 05082017 edelthemen ausgabeprobefahrtkonntedie welt gesegelterlebnismeile und sailingdie in poleneinen neueneinmalschoten38baukunsttrimaran tf10tf10 soll helfen30team brunelrace starhat dieauf ihrerdas foilenobtvtipps termine blogsder 35crewsjollenkreuzer gepaart mitannehmlichkeitenmit demdehlyaausrstung panoramabilder von der46 im testist frhansesie schonabo ausgabe bestellenfoilen salonfhig zutrugenvom exklusivtest dernochweiterkrioserkundet wird nikekaribiknchsten fahrtenbootgenerationmit vieldem zuknftig derersten trnsihresgleicheneinj 70sdie einhandregattanrvstar sailorssailingsegelreviere reportagen downloadwinschen neueverlngert fotos vonwochenende war44der schleifehler vonhochseeregattaprogrammder hamburgersind karinallesheft abonnierenheft abonnieren digitaleinigefactory china mcconaghywird nike steigersorgenfreilassenhilfeoceanwettfahrten aufkielabonnieren yacht digitaldie besten bilderoder foilenschimmel zurckmedienlandschaft auf jsailing conductors36 karlseinessternen klassifiziert einsucht doch kommt11082017 haikutterregattajetzt05072017 elfjedenunserer dehlyasegler und buntesmit 80digitales magazinder schimmelbesten bilderdas erstemeterheibeck hatist ein bisschenc65bereitswir habenbeiboot mitrasanter xxljolli mitausgetragenen mediacupsport ampflensburgerpeterdas besondereungewhnlich spannendenelbe die bestenvermeidbarenden arbeitenreiseplanung reiseforumihresgleichen sucht dochoceanis 511erhltlichhtteerstmalsdigital abo ausgabeoceanisspezielle48die einhandregatta rundsport amp actionsunausgabe newsletter gewinnspieltraditionellenerstmals ausgetragenenfu verlngert fotosbesonderebeimyacht an die08072017schmuckstckgesegelt einedownloadaufgegangenbilanzfotowettbewerbwochenende war dieseemannschaft testportrt imam wochenendeyachtsbaycruiser 26sailors leaguezweitwasserung der blackauenalsternachdreieckskurs zu messenausrstung ausrstungstestsstarke eindrckeein neues beiboottest ampblauwasser eindiespannendentausche tastaturauf der flensburgerseinerbruder 28072017 esums43digitales magazin heftarchivmehrzwlferfestdie ihresgleichenwolframlang beharktenamp technik werkstatt10viel charmedie erstendie neuemagazin heftarchiv abosonntag 13reiseplanungcup volvo oceander karibikwochenendekommt diebluesound rasanter xxljollibisschensind gleich13 august istausgabe bestellen heft15fr die reinke7erlebnismeiletausche tastatur gegenmacht sichchartern die tophamburger1224jrgen schultzerhlsich an einemstarketraditionellen dreieckskurs zuim test 05082017vergangenen wochenende kamendie handwerklicheausgetragenentechnikeinem traditionellenganzenihresgleichen suchtder typischenmedienlandschaft aufglobe olympische spieleblack maggy 15082017league vendeneue ausrstung panoramanikesjedermannseglerwirinhaltsverzeichnisse kalenderbltterknnenfr dasocean race starunterconductors bis sonntagseptembergaleriemaggyberichtammerseeletztewolfram heibeck hatber die46klassiker zusammenwochenende kamentest 05082017aktuellpatient teakdeck teilhat ihrenberburlingein leben aufarbeiten und eindrckenichttauschemcconaghy factoryreportagen downloadboote bootstests gebrauchtbootstestsmachen 15082017auf einem traditionellender hanseauf jmit dem zuknftigfahrtenbootgeneration von weltmarktfhrerblauwasservergleichstestkarls kleiner bruderlangespieletagemagazinsindsee ichdas erste maltastaturleben auf seeauenpostender aktuellen ausgabe49ausrstung neue ausrstungjozefnews segelreviere reportagen9auftakteinhandregattajetzt erhltlich themenbeharktengegen pinne 13082017zeitkalenderbltter fotowettbewerbflaggschiff comfortinaannehmlichkeiten eineshanse 548schnstenwie diegleichdeutschezweiwenn manneue boote neuenrv mediasegeln sie nochdreieckskurstrimaransucht doch50von jozef kubicaveranstaltungstipp groefactory chinadeutschen medienlandschaft aufwerkbietetim filmein augenschmausreportagenheftarchivrevierberichtbeneteau als ersteseinerhafen weiter aufgewertetgegen pinnevielsoll38 jahrelang beharkten sichdie extremeauf usedom18schultzerhlwindjammerfahrtengroenorwegensailing seriesabo inhaltsverzeichnisse kalenderbltterhamburg spannendecupklassifiziert ein kleinesvariabilittaktuelle ausgabe newsletterzaubermediacup des nrvpatient teakdeckfrde ihremediacup desweltmarktfhrer beneteauzuknftig dermcconaghyedel und elegantweltneue bootethemen36langenyacht digital aboexklusivtest derklassikernews versicherungsnews tvtippskauftkonnte das auftaktmodellzusammendreieckskurs zunurein bisschen wieelf 12mryachten trugenlinievon den ersten29072017 in der33hamburg spannende off24072017 dereiner variabilittjvon derder bluesoundtermine blogscomfortina 46ausrstungsables dolonnedem zuknftigfahrtenbootgeneration vonxxljolli mit deckssalonamericas cup volvokarin und jrgengesegelt erste fotostraditionellen dreieckskurs12mr europameisterschaftdas portrt imsalonfhig zu machen15082017 amolympischexxljolli mitbrunelflensburg 05072017ohnemcconaghy factory chinaextreme sailing serieswartenwird dases ist29wie manamp technikaction seemannschafterstenankerplatzeinem tagpanorama sportmedia cupauf see ichseriestraditionsklassenmeeting ammerseekleinesonboardbilder von jozefdazuosmoseauchvendeweitereder testzu messenweltmarktfhrersegelrevierewrde dasverlassenspannenden konzeptserhltlich themen ausgabekonstrukteurum die welt40 fuankerplatz erkundet wirdmessenmit viel charme39fustahlyacht kriosdreifertigtnaturhafen mit vielvom 10 traditionsklassenmeetingjozef kubicagelingtsailing series segelactionneue ausrstung ausrstungstestszwlferfest in flensburggastvonmotornike steigerder blackersten bilder einesetwas31fuvergleichalsverlngert fotosder bluesound ausseinactionfehler von chartercrewsjahre langhat nikelangenargenles sables dolonnevergleichstest kompaktklasse 31fuvergleichkleineeindrcke vomendekamenein neuesist einj classwinschender revierberichtsegeltkatheftinfo yachtfoilen salonfhigperformancecruiser flaggschifftypischen fehlerneueshaidie ersten bildermachtsacheholzbeidie extreme sailingpreisebeneteau oceanis 511sehralle newsyachtensteigeralleinrostockheibeck6deckssalon41mit einerclasschina mcconaghybesondere boot bootsforumreviersich nichtausrstung neue15082017 am wochenendemit46 imden erstenaufsgesegelt ersteder flensburgerwerkstatteindrcke vontest amp technikfigarospannendedesklassifiziert einaction seemannschaft testbeneteau oceanisboote neue ausrstung12mr europameisterschaft ausrevierbericht im pdfdownloadwrdemagazin segelneinemfotos vonfastdieserjahrendie genedie kleine12mryachtenaugust istgroeneindrcke von denpdfdownloadostsee naturhafen mitvon dendas foilen salonfhigamsterdamthemen ausgabe bestellenweihnachten fr dieextreme sailingaus les sablesmit den annehmlichkeitensternensegelaction auf derzu macheninhaltsverzeichnisse kalenderbltter fotowettbewerbklassikernjahre lang sindreiseberichtocean race24072017 der trimaranpeter burlingmit deckssalonschweizii70s beim erstmalsopen 32ihrer 39fustahlyachtcrews auszurckeigenersich nike mitzu neuenkamen zahlreiche klassikerlangschiffrace star sailorsspiritder nchstensuchtwieder machenbestenausgabe28072017 es istsegelsichabo ausgabeostsee naturhafenshelterkeineshelter baylosteil 1der elbe diecup tauschebootbesserauswahlfigaro 3beneteausonntagusedomgewinnspieltag in vieraufdemsoll helfen12mryachten trugenreinkeihrerzurck aufelegant dazublauwasser ein lebenbigagepaartmeterklasse starkegebrauchtbootstests dasneue hochseeregattazwischenschultzerhl auf ihrerextremesie schon 24072017kubica extremeeine bilanzdas auftaktmodell dervergleichstest kompaktklasse12mryachten trugen aufam vergangenendie weltdazu mit einernaturhafen mitelegantes gibtmagazin aktuellevolvo ocean racevergangenen wochenendekarls kleinerbootstypen aufgegangen diesegeln eindrcke ausdigital aboschnsun odyssey 440heftinfoaufstiegshilfender neuenlang sind karinpanorama sport ampreisenewslos in rostockpinnelesum diekosihrer 39fustahlyacht kriosspiele alleein kleines schmuckstckboote bootstestsschleikalenderblttereuropameisterschaft34vom exklusivtestdas besondere bootversicherungsnewsbisherdie kleine marinafotos vomlsstwerdentypischenmarinanikeregattanews reisenews klassikernews32 fraus derder deutschender test imschon gesegelt erstethemen der aktuellensegelaction aufschoten und einallernewsamericas cup11panorama regattanews reisenewsfahrtder aktuellentage lang beharktenyawlmit einer variabilittberking 12mrsie mittest immachen dieunserermit karlbluesound aus dererhltlich themen

Longtail Keyword Density for Yacht.de

nike steiger vlog58
volvo ocean race14
der test im12
um die welt12
test im pdf-download12
extreme sailing series11
auf der elbe8
portrt im pdf-download8
das portrt im8
von chartercrews teil6
fehler von chartercrews6
es ist ein6
die yacht konnte6
typischen fehler von6
chartern die top6
steiger vlog 366
die welt gesegelt6
die top 166
top 16 der6
der typischen fehler6
16 der typischen6
jetzt erhltlich themen5
das besondere boot5
karl nike steiger5
themen ausgabe bestellen5
aus der deutschen5
beneteau oceanis 5115
sun odyssey 4405
erhltlich themen ausgabe5
heft abonnieren digital5
ausgabe bestellen heft5
bestellen heft abonnieren5
war die extreme4
die extreme sailing4
wochenende war die4
15082017 am wochenende4
bilder 15082017 am4
sailing series zur4
am wochenende war4
gast in hamburg4
von jozef kubica4
bilder von der4
onboard-bilder von jozef4
off- und onboard-bilder4
vergleichstest kompaktklasse 31-fu-vergleich4
hamburg spannende off-4
series zur gast4
nach der ersten4
wie man die4
patient teakdeck teil4
zurck an die4
segel-action auf der4
series segel-action auf4
sailing series segel-action4
der elbe die4
elbe die besten4
besten bilder 150820174
der schimmel zurck4
macht sich nike4
hat nike steiger4
die besten bilder4
kleb- und dichtmassen4
gegen die osmose4
der ankerplatz erkundet4
aufgegangen die gene4
die gene vom4
bootstypen aufgegangen die4
mehrere bootstypen aufgegangen4
gleich mehrere bootstypen4
gene vom jollenkreuzer4
vom jollenkreuzer gepaart4
den annehmlichkeiten eines4
annehmlichkeiten eines tourers4
mit den annehmlichkeiten4
gepaart mit den4
jollenkreuzer gepaart mit4
sind gleich mehrere4
schweiz sind gleich4
bluesound rasanter xxl-jolli4
rasanter xxl-jolli mit4
von damals heran4
baukunst von damals4
handwerkliche baukunst von4
xxl-jolli mit deckssalon4
mit deckssalon 290720174
aus der schweiz4
der schweiz sind4
bluesound aus der4
der bluesound aus4
29072017 in der4
vlog 36 karls4
36 karls kleiner4
neues beiboot mit4
beiboot mit dem4
ein neues beiboot4
schoten und ein4
winschen neue schoten4
mit dem zuknftig4
dem zuknftig der4
erkundet wird nike4
wird nike steiger4
ankerplatz erkundet wird4
tf10 segeln sie4
zuknftig der ankerplatz4
neue winschen neue4
reinke neue winschen4
28072017 es ist4
ist ein bisschen4
bruder 28072017 es4
kleiner bruder 280720174
karls kleiner bruder4
ein bisschen wie4
bisschen wie weihnachten4
die reinke neue4
fr die reinke4
weihnachten fr die4
wie weihnachten fr4
das erste mal4
trimaran tf10 soll4
frde ihre robbe4
ihre robbe berking4
flensburger frde ihre4
der flensburger frde4
auf der flensburger4
robbe berking 12-mr-4
berking 12-mr- europameisterschaft4
klassiker eindrcke vom4
yacht-fotograf nico krauss4
europameisterschaft aus galerie4
12-mr- europameisterschaft aus4
trugen auf der4
12-mr-yachten trugen auf4
les sables dolonne4
meterklasse starke eindrcke4
aus les sables4
eindrcke aus les4
segeln eindrcke aus4
starke eindrcke vom4
eindrcke vom zwlfer-fest4
elf 12-mr-yachten trugen4
05072017 elf 12-mr-yachten4
flensburg 05072017 elf4
zwlfer-fest in flensburg4
eindrcke vom 104
vom 10 traditionsklassen-meeting4
auf einem traditionellen4
einem traditionellen dreieckskurs4
wettfahrten auf einem4
vier wettfahrten auf4
tag in vier4
traditionellen dreieckskurs zu4
dreieckskurs zu messen4
revierbericht im pdf-download4
der revierbericht im4
bootsportrt im pdf-download4
das bootsportrt im4
sich an einem4
zusammen um sich4
19062017 am vergangenen4
ammersee 19062017 am4
traditionsklassen-meeting ammersee 190620174
10 traditionsklassen-meeting ammersee4
am vergangenen wochenende4
vergangenen wochenende kamen4
klassiker zusammen um4
zahlreiche klassiker zusammen4
kamen zahlreiche klassiker4
wochenende kamen zahlreiche4
magazin segeln eindrcke4
erstes magazin segeln4
zu machen die4
machen die ersten4
salonfhig zu machen4
foilen salonfhig zu4
das foilen salonfhig4
die ersten bilder4
ersten bilder eines4
spannenden konzepts exklusiv4
ungewhnlich spannenden konzepts4
eines ungewhnlich spannenden4
bilder eines ungewhnlich4
helfen das foilen4
soll helfen das4
foilen sie schon4
oder foilen sie4
noch oder foilen4
sie noch oder4
sie schon 240720174
schon 24072017 der4
tf10 soll helfen4
die handwerkliche baukunst4
der trimaran tf104
24072017 der trimaran4
konzepts exklusiv bei4
exklusiv bei yacht4
auftaktmodell der nchsten4
der nchsten fahrtenboot-generation4
das auftaktmodell der4
konnte das auftaktmodell4
yacht konnte das4
nchsten fahrtenboot-generation von4
fahrtenboot-generation von weltmarktfhrer4
als erstes magazin4
beneteau als erstes4
weltmarktfhrer beneteau als4
von weltmarktfhrer beneteau4
20072017 die yacht4
511 20072017 die4
erste fotos vom4
gesegelt erste fotos4
schon gesegelt erste4
bei yacht online4
fotos vom exklusivtest4
vom exklusivtest der4
oceanis 511 200720174
neuen beneteau oceanis4
der neuen beneteau4
exklusivtest der neuen4
segeln sie noch4
die in polen4
von den arbeiten4
fotos von den4
verlngert fotos von4
arbeiten und eindrcke4
eindrcke von den4
blauwasser ein leben4
den ersten trns4
von den ersten4
fu verlngert fotos4
40 fu verlngert4
die einhand-regatta rund4
fr die einhand-regatta4
32 fr die4
einhand-regatta rund fnen4
rund fnen auf4
yacht an die4
fnen auf 404
ein leben auf4
leben auf see4
lang sind karin4
jahre lang sind4
38 jahre lang4
karin und jrgen4
jrgen schultze-rhl auf4
auf ihrer 39-fu-stahlyacht4
schultze-rhl auf ihrer4
15082017 38 jahre4
machen 15082017 384
ich wrde das4
see ich wrde4
auf see ich4
wrde das sofort4
das sofort wieder4
wieder machen 150820174
sofort wieder machen4
open 32 fr4
seinen open 324
krummin hat ihren4
marina in krummin4
die kleine marina4
hat ihren hafen4
ihren hafen weiter4
mit vier sternen4
aufgewertet und mit4
hafen weiter aufgewertet4
16082017 die kleine4
charme 16082017 die4
sich nike mit4
magazin aktuelle ausgabe4
digitales magazin aktuelle4
ostsee naturhafen mit4
naturhafen mit viel4
viel charme 160820174
mit viel charme4
vier sternen klassifiziert4
sternen klassifiziert ein4
maggy 15082017 wolfram4
black maggy 150820174
der black maggy4
15082017 wolfram heibeck4
wolfram heibeck hat4
hat seinen open4
heibeck hat seinen4
zweitwasserung der black4
die zweitwasserung der4
kleines schmuckstck auf4
ein kleines schmuckstck4
klassifiziert ein kleines4
schmuckstck auf usedom4
umbau operation silverrudder4
silverrudder die zweitwasserung4
operation silverrudder die4
ihrer 39-fu-stahlyacht krios4
auf 40 fu4
beim erstmals ausgetragenen4
70s beim erstmals4
j 70s beim4
erstmals ausgetragenen media-cup4
ausgetragenen media-cup des4
nrv auf der4
des nrv auf4
media-cup des nrv4
auf j 70s4
medienlandschaft auf j4
beharkten sich crews4
lang beharkten sich4
tage lang beharkten4
sich crews aus4
crews aus der4
deutschen medienlandschaft auf4
der deutschen medienlandschaft4
auf der hamburger4
der hamburger auenalster4
variabilitt die ihresgleichen4
einer variabilitt die4
39-fu-stahlyacht krios um4
die ihresgleichen sucht4
ihresgleichen sucht doch4
polen gebaute yacht4
doch kommt die4
sucht doch kommt4
dazu mit einer4
elegant dazu mit4
comfortina 46 im4
flaggschiff comfortina 464
performance-cruiser flaggschiff comfortina4
46 im test4
im test 050820174
edel und elegant4
test 05082017 edel4
drei tage lang4
mit einer variabilitt4
11082017 haikutter-regatta windjammer-fahrten4
sail 11082017 haikutter-regatta4
hanse sail 110820174
haikutter-regatta windjammer-fahrten erlebnismeile4
erlebnismeile und sailing4
conductors bis sonntag4
sailing conductors bis4
der hanse sail4
auf der hanse4
welt gesegelt eine4
krios um die4
13082017 drei tage4
gesegelt eine bilanz4
segler und buntes4
programm auf der4
buntes programm auf4
bis sonntag 134
veranstaltungstipp groe segler4
media cup tausche4
nrv media cup4
cup tausche tastatur4
tausche tastatur gegen4
sonntag 13 august4
tastatur gegen pinne4
gegen pinne 130820174
rostock und warnemnde4
13 august ist4
pinne 13082017 drei4
ist viel los4
august ist viel4
los in rostock4
klassiker-news versicherungs-news tv-tipps3
versicherungs-news tv-tipps termine3
neue ausrstung panorama3
ausrstung panorama regatta-news3
reise-news klassiker-news versicherungs-news3
regatta-news reise-news klassiker-news3
panorama regatta-news reise-news3
neue boote bootstests3
gebrauchtbootstests das besondere3
besondere boot boots-forum3
ausrstung neue ausrstung3
bootstests gebrauchtbootstests das3
boote bootstests gebrauchtbootstests3
termine blogs alle3
blogs alle news3
boote neue ausrstung3
tv-tipps termine blogs3
zu messen klassiker3
abonnieren yacht digital3
neue ausrstung ausrstungs-tests3
yacht digital abo3
der aktuellen ausgabe3
themen der aktuellen3
yacht abonnieren yacht3
heft-info yacht abonnieren3
digital abo ausgabe3
abo ausgabe bestellen3
seemannschaft test amp3
test amp technik3
amp technik werkstatt3
action seemannschaft test3
amp action seemannschaft3
panorama sport amp3
sport amp action3
neue boote neue3
heft-info digitales magazin3
reinke super 103
abo heft-info yacht3
aktuelle ausgabe newsletter3
news digitales magazin3
classic news digitales3
abo inhaltsverzeichnisse kalenderbltter3
inhaltsverzeichnisse kalenderbltter fotowettbewerb3
ausgabe newsletter gewinnspiel3
zum volvo ocean3
182017 jetzt erhltlich3
jozef kubica extreme3
kubica extreme sailing3
yacht 182017 jetzt3
untie the lines3
mcconaghy factory china3
factory china mcconaghy3
heft-archiv abo inhaltsverzeichnisse3
magazin heft-archiv abo3
cup volvo ocean3
ocean race star3
race star sailors3
americas cup volvo3
download reiseplanung reise-forum3
segelreviere reportagen download3
reportagen download reiseplanung3
star sailors league3
sailors league vende3
spiele alle news3
magazin heft-info digitales3
digitales magazin heft-archiv3
olympische spiele alle3
globe olympische spiele3
league vende globe3
vende globe olympische3
news segelreviere reportagen3
nike steiger62
steiger vlog58
im pdf-download40
auf der30
americas cup17
fr die15
aus der15
von der14
volvo ocean14
die welt14
ocean race14
um die12
der test12
test im12
extreme sailing11
sailing series11
im test10
mit dem10
mit karl10
es ist10
oceanis 5119
mit den8
sich nike8
eindrcke vom8
16082017 die8
yacht classic8
die yacht8
geht es8
der elbe8
die reinke8
von den8
das portrt8
portrt im8
ausgabe bestellen8
bei der8
der neuen8
refit-blog woche8
ist die8
beneteau oceanis7
neue ausrstung7
sun odyssey7
dehlya 257
digitales magazin7
auf ihrer6
comfortina 466
welt gesegelt6
vlog 366
hat die6
nach der6
wie man6
es gibt6
machen die6
auf einem6
sie mit6
ein neues6
jahre lang6
besten bilder6
eindrcke von6
ist fr6
mit der6
macht sich6
den mast6
der hamburger6
einen neuen6
yacht konnte6
yacht online6
gibt es6
wenn man6
mit einer6
top 166
16 der6
der typischen6
teil 26
wie die6
im film6
nico krauss6
die top6
chartern die6
von chartercrews6
chartercrews teil6
ist ein6
neue boote6
alle news6
typischen fehler6
fehler von6
jetzt erhltlich5
erhltlich themen5
der deutschen5
zu neuen5
die besten5
tv-tipps termine5
amp technik5
das besondere5
bestellen heft5
heft abonnieren5
besondere boot5
themen ausgabe5
abonnieren digital5
kieler woche5
odyssey 4405
karl nike5
erkundet wird4
die osmose4
gegen die4
erste mal4
ankerplatz erkundet4
series segel-action4
der ankerplatz4
fr das4
ein augenschmaus4
da es4
das erste4
die meisten4
auf karl4
segel-action auf4
wird nike4
wird sie4
elbe die4
vor allem4
neues beiboot4
war die4
die extreme4
series zur4
hamburg spannende4
zur gast4
wochenende war4
am wochenende4
unserer dehlya4
mal wieder4
dem zuknftig4
bilder 150820174
beiboot mit4
15082017 am4
zuknftig der4
trifft sich4
hat nike4
der ersten4
der 354
shelter bay4
zurck auf4
der schimmel4
schimmel zurck4
ist das4
nike steigers4
teil 14
nicht die4
ber die4
auf den4
auf die4
baycruiser 264
sich nicht4
der yacht4
welt des4
biga 2704
sind schnell4
ist es4
die arbeit4
mit freunden4
die neue4
nike ihren4
man die4
patient teakdeck4
vergleichstest kompaktklasse4
der erste4
teakdeck teil4
kompaktklasse 31-fu-vergleich4
zu verlassen4
sie sich4
tf10 soll4
noch einmal4
mit 804
eine auswahl4
aus galerie4
12-mr- europameisterschaft4
europameisterschaft aus4
yacht-fotograf nico4
j class4
traditionsklassen-meeting ammersee4
ammersee 190620174
10 traditionsklassen-meeting4
vom 104
klassiker eindrcke4
berking 12-mr-4
robbe berking4
flensburg 050720174
05072017 elf4
vom zwlfer-fest4
starke eindrcke4
sables dolonne4
meterklasse starke4
elf 12-mr-yachten4
12-mr-yachten trugen4
frde ihre4
ihre robbe4
flensburger frde4
der flensburger4
trugen auf4
19062017 am4
am vergangenen4
revolution 294
der schlei4
fr jedermann4
der marke4
nach oben4
wird das4
das bootsportrt4
bootsportrt im4
der revierbericht4
revierbericht im4
wir haben4
zwei jahre4
fr eine4
zu messen4
dreieckskurs zu4
zahlreiche klassiker4
klassiker zusammen4
kamen zahlreiche4
wochenende kamen4
vergangenen wochenende4
zusammen um4
um sich4
einem traditionellen4
traditionellen dreieckskurs4
wettfahrten auf4
vier wettfahrten4
einem tag4
les sables4
aus les4
soll helfen4
helfen das4
trimaran tf104
der trimaran4
schon 240720174
24072017 der4
das foilen4
foilen salonfhig4
ersten bilder4
bilder eines4
die ersten4
zu machen4
salonfhig zu4
sie schon4
foilen sie4
bilder von4
hanseyachts hanse4
die erste4
jozef kubica4
onboard-bilder von4
von jozef4
neuen linie4
die werft4
noch oder4
oder foilen4
sie noch4
segeln sie4
tf10 segeln4
eines ungewhnlich4
ungewhnlich spannenden4
fahrtenboot-generation von4
von weltmarktfhrer4
nchsten fahrtenboot-generation4
der nchsten4
das auftaktmodell4
auftaktmodell der4
weltmarktfhrer beneteau4
beneteau als4
segeln eindrcke4
eindrcke aus4
magazin segeln4
erstes magazin4
als erstes4
konnte das4
20072017 die4
bei yacht4
schon gesegelt4
exklusiv bei4
konzepts exklusiv4
spannenden konzepts4
gesegelt erste4
erste fotos4
neuen beneteau4
511 200720174
exklusivtest der4
vom exklusivtest4
fotos vom4
spannende off-4
eines tourers4
ein leben4
blauwasser ein4
ersten trns4
den ersten4
leben auf4
neue schoten4
das sofort4
wrde das4
ich wrde4
see ich4
den arbeiten4
fotos von4
einhand-regatta rund4
die einhand-regatta4
32 fr4
open 324
rund fnen4
fnen auf4
verlngert fotos4
fu verlngert4
40 fu4
auf 404
sofort wieder4
wieder machen4
buntes programm4
groe segler4
veranstaltungstipp groe4
eine bilanz4
programm auf4
der hanse4
haikutter-regatta windjammer-fahrten4
11082017 haikutter-regatta4
sail 110820174
hanse sail4
gesegelt eine4
krios um4
lang sind4
38 jahre4
15082017 384
machen 150820174
sind karin4
jrgen schultze-rhl4
39-fu-stahlyacht krios4
ihrer 39-fu-stahlyacht4
schultze-rhl auf4
seinen open4
hat seinen4
die kleine4
charme 160820174
viel charme4
mit viel4
kleine marina4
krummin hat4
weiter aufgewertet4
hafen weiter4
ihren hafen4
hat ihren4
naturhafen mit4
ostsee naturhafen4
aktuelle ausgabe4
magazin aktuelle4
classic news4
vende globe4
sich die4
klassische yachten4
macht das4
ganz allein4
nicht ganz4
nike mit4
mit vier4
vier sternen4
zweitwasserung der4
die zweitwasserung4
silverrudder die4
operation silverrudder4
der black4
black maggy4
heibeck hat4
wolfram heibeck4
15082017 wolfram4
maggy 150820174
umbau operation4
der woche4
kleines schmuckstck4
ein kleines4
klassifiziert ein4
sternen klassifiziert4
schmuckstck auf4
auf usedom4
im norden4
september die4
neue hochseeregatta4
windjammer-fahrten erlebnismeile4
auf see4
rasanter xxl-jolli4
xxl-jolli mit4
bluesound rasanter4
damals heran4
von damals4
mit deckssalon4
deckssalon 290720174
schweiz sind4
der schweiz4
bluesound aus4
der bluesound4
baukunst von4
handwerkliche baukunst4
ihresgleichen sucht4
die ihresgleichen4
variabilitt die4
einer variabilitt4
sucht doch4
doch kommt4
die handwerkliche4
gebaute yacht4
polen gebaute4
kommt die4
sind gleich4
gleich mehrere4
ein bisschen4
28072017 es4
bruder 280720174
kleiner bruder4
bisschen wie4
wie weihnachten4
winschen neue4
neue winschen4
reinke neue4
weihnachten fr4
karls kleiner4
36 karls4
die gene4
sailing conductors4
bootstypen aufgegangen4
mehrere bootstypen4
gene vom4
vom jollenkreuzer4
annehmlichkeiten eines4
den annehmlichkeiten4
gepaart mit4
jollenkreuzer gepaart4
dazu mit4
aufgegangen die4
13082017 drei4
pinne 130820174
gegen pinne4
tastatur gegen4
drei tage4
tage lang4
sich crews4
beharkten sich4
lang beharkten4
tausche tastatur4
media cup4
sonntag 134
bis sonntag4
elegant dazu4
conductors bis4
13 august4
august ist4
nrv media4
viel los4
ist viel4
crews aus4
cup tausche4
deutschen medienlandschaft4
ausgetragenen media-cup4
erstmals ausgetragenen4
beim erstmals4
media-cup des4
05082017 edel4
performance-cruiser flaggschiff4
hamburger auenalster4
nrv auf4
des nrv4
flaggschiff comfortina4
70s beim4
46 im4
auf j4
j 70s4
medienlandschaft auf4
test 050820174
technik werkstatt3
boote neue3
panorama regatta-news3
messen klassiker3
ausrstung panorama3
regatta-news reise-news3
klassiker-news versicherungs-news3
bootstests gebrauchtbootstests3
gebrauchtbootstests das3
boot boots-forum3
ausrstung neue3
boote bootstests3
blogs alle3
test amp3
versicherungs-news tv-tipps3
termine blogs3
reise-news klassiker-news3
digital abo3
heft-info yacht3
peter burling3
team brunel3
aktuellen ausgabe3
der aktuellen3
themen der3
abo heft-info3
ausrstung ausrstungs-tests3
yacht abonnieren3
sport amp3
amp action3
action seemannschaft3
panorama sport3
abo ausgabe3
abonnieren yacht3
yacht digital3
seemannschaft test3
inhaltsverzeichnisse kalenderbltter3
ausgabe newsletter3
newsletter gewinnspiel3
mcconaghy factory3
factory china3
china mcconaghy3
kalenderbltter fotowettbewerb3
news digitales3
zum volvo3
der karibik3
reinke super3
yacht 1820173
182017 jetzt3
super 103
hanse 5483
kubica extreme3
figaro 33
abo inhaltsverzeichnisse3
heft-archiv abo3
cup volvo3
race star3
star sailors3
reiseplanung reise-forum3
download reiseplanung3
segelreviere reportagen3
reportagen download3
sailors league3
league vende3
heft-info digitales3
magazin heft-archiv3
magazin heft-info3
spiele alle3
globe olympische3
olympische spiele3
news segelreviere3

What are the nameservers for yacht.de?

Yacht.de Domain Nameserver Information

HostIP AddressCountry
ns1.adns2.de Germany
ns2.adns2.de Germany

Yacht.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yacht.de is a scam?