Yahoo.ca  |  Yahoo
Low trust score  | 
News, email and search are just the beginning. Discover more every day.




Yahoo.ca Website Information

Website Ranks & Scores for Yahoo.ca

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:837,389
Majestic Rank Majestic Rank:26,695
Domain Authority Domain Authority:65%
DMOZ DMOZ Listing:No

Whois information for yahoo.ca

Full Whois Lookup for Yahoo.ca Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Yahoo.ca. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name: yahoo.ca
Domain status: registered
Creation date: 2000/10/03
Expiry date: 2017/09/21
Updated date: 2016/08/20
DNSSEC: Unsigned

Registrar:
Name: MarkMonitor International Canada Ltd.
Number: 5000040

Registrant:
Name: Yahoo! Canada Co.

Administrative contact:
Name: Michelle Kintz
Postal address: 207 Queens Quay West, Suite 801,
Toronto ON M5J1A7 Canada
Phone: +1.4163418605x
Fax: +1.4163418800
Email: Login to show email
contact:
Name: Matt Serlin
Postal address: Domain Provisioning,10400 Overland Rd. PMB 155
Boise ID 83709 United States
Phone: +1.2083895740x
Fax: +1.2083895771
Email: Login to show email
servers:
ns1.yahoo.com
ns2.yahoo.com
ns3.yahoo.com
ns5.yahoo.com
ns7.yahoo.com

% WHOIS look-up made at 2017-08-19 09:31:01 (GMT)
%
% Use of CIRA's WHOIS service is governed by the Terms of Use in its Legal
% Notice, available at http://www.cira.ca/legal-notice/?lang=en
%
% (c) 2017 Canadian Internet Registration Authority, (http://www.cira.ca/)

Who hosts Yahoo.ca?

Yahoo.ca is hosted by Yahoo! in California, Sunnyvale, United States, 94089.
Yahoo.ca has an IP Address of 74.6.50.24 and a hostname of w2.src1.vip.bf1.yahoo.com and runs ATS web server.



Yahoo.ca Web Server Information

Hosted IP Address:74.6.50.24
Hosted Hostname:w2.src1.vip.bf1.yahoo.com
Service Provider:Yahoo!
Hosted Country:United StatesUS
Location Latitude:37.4249
Location Longitude:-122.0074
Webserver Software:ATS

HTTP Header Analysis for Yahoo.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 23 Sep 2015 01:01:40 GMT
P3P: policyref="http://info.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
Strict-Transport-Security: max-age=2592000
X-Frame-Options: DENY
Vary: Accept-Encoding
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Age: 0
Transfer-Encoding: chunked
Connection: keep-alive
Via: http/1.1 ir13.fp.ir2.yahoo.com (ApacheTrafficServer)
Server: ATS
Cache-Control: no-store, no-cache, private, max-age=0
Expires: -1


Need to find out who hosts Yahoo.ca?

Yahoo.ca Free SEO Report

Website Inpage Analysis for Yahoo.ca

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yahoo.ca

nonexpaftransport pathnew datefullw window0expires expiresuserprovideddatafacstatuslatestcustomers0 size 300x250windowaddeventlistener windowaddeventlistenerload functionbehavior nonexprequires nodenew tabbodytagclassnameymediamyappgetrapidtrackerwindowismodalopenyuiusenodebaseundefined varyahooyuiusenodebase functiony300x250size 300x250 bookidloaddefaultbundlepressbarcelonaovermmynameexpires newpathdataviewscale15windowafconfigfontsizebodytagbookidexppush21503135062019195 behaviordont youadrelatedmatchidifwindowxzqdnullwindowxzqdnewif eventname hladsalladcollapsecollapsefdbi dontplacementidcuradlabeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose adshowadshow adcollapsecollapsefdbiundefinedkeep upcreativeid4game0 sizearial sansseriffontweightnews the canadianuserprovideddata htmlthereelse if9domain locationhostnamefdbexpfunction varrainwindowperformance windowperformancenow varadcodeenca is3rdis3rd 1 userprovideddataalsofdburladindexsignin to likeoutif windowaddeventlistener windowaddeventlistenerloadservetime 1503135062019195origheightelsesuppugc 0 placementidwindowperformancenowyour newnumber integeronlinelikebodytag documentgetelementsbytagnamebody02pxnodewindowperformancenoothermastvar w windowscalex1if windowaddeventlistenerladcollapsecollapsefdbitypenifwindowxzqdnullwindowxzqdnewymediaonenullincreasenextservetime 1503135062019195 behaviorresultsnowfunctiondatalocaleswedrismonfetchinteger1503135062019195 behavior nonexp12tryifrequires aftransport pathmailboxesidwindowperformancenow var ltimeyou havesfdontdomainsignin7newis3rd 1adc labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose adshowadshowcuradclassnamereplacednenca slotdatafunctionurlhasexternal 0 sizemaydategettimeukif windowperformance windowperformancenowhelvetica neue999999999999999999999999 err facstatuscontenthladsall eventnameerrtopfdbonvisible1 slotidwindowafhelvetica arialnewwidthwindowperformancenow varbaby0 placementidslotdatatab and homeservetypehladscustomfindymediamyappluxuryforiyoull see1503142262019 fdbintl enca300x250 bookidmeta y cschtmlcanwindowremoveeventlistenerloadus1x1suppugc 0adcmatchid 999999999999999999999999 errmsgnamepageparamsobjectybackfontfamily helveticaoneneue helvetica arialymediameta yvar ltime windowperformancenowelocationfalse else iflessvar wgreenerecentblur30px11adshowadshow adcollapsecollapsefdbi dontadc labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclosesize 300x250metafdbintlrequirespositemhaserr positemsize 1x1new dategettimebehaviorstartedif windowperformancehelveticaaftransportus morerapidinstanceview yourltimebreakingeventname hladsallyahoo to keephtmlthesefdbon 1 fdbexpthroughlike this adcodeencakeepselectdont likepositemsize 1x11 userprovideddataeventnametop of breakingfdb fdburlltime windowperformancenowfdbintl enca slotdatafdbexp 1503142262019downfinance1matchid 999999999999999999999999afterdatecheckfontfamily helvetica neuestaypositemconfcleancanadianrapidconfig1 fdbexp 1503142262019said8documentgetelementsbytagnamebody0 bodytagclassnamehighnewscuradclassnamebreaking newswrapencahladsall eventname hladscustomif msgnameherevar ltimeeventname hladsall eventnameexpires new dateadcollapsecollapsefdbi dont likedipage to yahoo999999999999999999999999 errtheyreturnskipupdatesstarted nowwinexpires domain locationhostnameenusif ymediamakepresidenteventname hladscustomfilterpossize1 fdbexpwindowaddeventlistenerload functionlabeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose adshowadshowmostnull ifhasexternal 0windowaddeventlistenerwindowperformance windowperformancenowimpidelbuty cschtml999999999999999999999999fontfamilyfdbexp 1503142262019 fdbintlfdbintl enusfdbintl encamathroundltime1503142262019 fdbintljourneyrequires node pathrequires pathpositemconfclean wraptabupvar bodytag documentgetelementsbytagnamebody0functionyyoudocumentgetelementsbytagnamebody05ymediaone positemconfclean wrapyoullmsgdataarialaft20pxidposname6you likeexpires expires domainsnowif eventnamee ifexpiresfitnessmailbehavior nonexp adidsearch15false elsenewheightsansseriffontweightlabeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadcloseexpires domainservetimejpositemhaserrcanadian presshasexternaldatrkcscurislotidyour new tabis3rdneededtypeofbodytag documentgetelementsbytagnamebody0 bodytagclassnamepositemhaserr positemsizelaterelse if msgdatadont you like10home pagestoriescuradclassname curadclassnamereplacednfalseorigwidthlocationhostnamenonexp adidsuppugcwindowaddeventlistenerloadneue helveticamoreerr facstatusscale15 scalex1getexecutionleftresourcetimingassetsposid13positemsizeseehelvetica neue helveticaservetype 1 slotidneueif msgdata3notadidexpovradcodeencapagefdbon 1pagemodeymreqidymreqidwcouldsee moretheirvaradshowadshowwidthtellyournumberwindowaddeventlistener windowaddeventlistenerloadrequires aftransporthelvetica arial sansseriffontweightneedrightsettimeoutfunctionerrorymediaone positemconfcleansavepslengthlangvar bodytaghisadshowadshow adcollapsecollapsefdbisizeinitialpageloadexpiressetminutesexpiresgetminutesafterpageloaddefaultdo14windowpositemservetype 1setherifmsgnamelowmodlangbundlesexpandedjobsnode pathfdbhomefunctionepositionbrowsercschtmltruemathrounddataafthladsallhasyahoo as yourhaveadcodeenca is3rd 1

Longtail Keyword Density for Yahoo.ca

KeywordsOccurences
font-family helvetica neue6
sign-in to like6
helvetica neue helvetica6
fdbon 1 fdbexp6
neue helvetica arial6
helvetica arial sans-seriffont-weight6
servetype -1 slotid4
labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose adshowadshow adcollapsecollapsefdbi4
adc labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose adshowadshow4
adshowadshow adcollapsecollapsefdbi dont4
var bodytag documentgetelementsbytagnamebody04
else if msgdata4
hasexternal 0 size4
bodytag documentgetelementsbytagnamebody0 bodytagclassname4
adcollapsecollapsefdbi dont like4
like this adcodeen-ca4
1503135062019195 behavior nonexp4
suppugc 0 placementid4
var w window4
meta y cschtml4
behavior nonexp adid4
servetime 1503135062019195 behavior4
news the canadian3
if windowaddeventlistener windowaddeventlistenerload3
windowaddeventlistener windowaddeventlistenerload function3
expires expires domain3
expires domain locationhostname3
windowperformancenow var ltime3
var ltime windowperformancenow3
requires node path3
requires af-transport path3
tab and home3
yahoo to keep3
your new tab3
windowperformance windowperformancenow var3
yahoo as your3
expires new date3
page to yahoo3
false else if3
1503142262019 fdbintl en-ca3
fdbintl en-ca slotdata3
top of breaking3
fdbexp 1503142262019 fdbintl3
1 fdbexp 15031422620193
0 size 300x2503
size 300x250 bookid3
matchid 999999999999999999999999 err3
adcodeen-ca is3rd 13
is3rd 1 userprovideddata3
positemhaserr positemsize 1x13
999999999999999999999999 err facstatus3
ymediaone positemconfclean -wrap3
hladsall eventname hladscustom3
eventname hladsall eventname3
dont you like3
if eventname hladsall3
if windowperformance windowperformancenow3
requires path24
number integer9
else if8
helvetica neue6
1 fdbexp6
neue helvetica6
arial sans-seriffont-weight6
helvetica arial6
fdbon 16
dont like6
font-family helvetica6
if windowperformance5
started now5
windowperformance windowperformancenow5
if ymedia5
meta y5
if msgdata5
var bodytag4
-1 slotid4
if msgname4
fdb fdburl4
bodytag documentgetelementsbytagnamebody04
adshowadshow adcollapsecollapsefdbi4
ltime windowperformancenow4
breaking news4
adcodeen-ca is3rd4
documentgetelementsbytagnamebody0 bodytagclassname4
labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose adshowadshow4
adcollapsecollapsefdbi dont4
adc labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose4
servetype -14
w window4
y cschtml4
0 placementid4
var w4
function var4
scale15 scalex-14
new tab4
servetime 15031350620191954
suppugc 04
us more4
hasexternal 04
nonexp adid4
0 size4
behavior nonexp4
1503135062019195 behavior4
expires new3
if windowaddeventlistener3
new date3
undefined var3
windowaddeventlistener windowaddeventlistenerload3
domain locationhostname3
expires domain3
expires expires3
yuiusenode-base functiony3
you have3
youll see3
see more3
af-transport path3
requires af-transport3
new dategettime3
requires node3
node path3
windowaddeventlistenerload function3
you like3
300x250 bookid3
size 300x2503
err facstatus3
fdbexp 15031422620193
1503142262019 fdbintl3
en-ca slotdata3
fdbintl en-ca3
999999999999999999999999 err3
matchid 9999999999999999999999993
your new3
view your3
home page3
keep up3
fdbintl en-us3
canadian press3
is3rd 13
1 userprovideddata3
false else3
positemsize 1x13
positemhaserr positemsize3
curadclassname curadclassnamereplaced-n3
ymediaone positemconfclean3
windowperformancenow var3
positemconfclean -wrap3
eventname hladscustom3
hladsall eventname3
dont you3
userprovideddata html3
null if3
e if3
eventname hladsall3
if eventname3
var ltime3
if94
var80
070
requires61
path60
your55
you43
138
font-size34
false25
like25
function24
true21
more21
new19
yahoo18
news15
213
else12
helvetica12
windowperformancenow12
position12
no11
y11
not11
us10
310
number9
dont9
size9
integer9
ad9
see9
expires9
now9
data9
j8
stories8
curadclassname8
l8
ymedia8
back8
return8
positem8
windowperformance8
lang8
top7
posname7
one7
breaking7
latest7
out7
try7
content7
snow7
e7
fdbon6
fdbintl6
have6
full6
neue6
eventname6
font-family6
get6
msgname6
name6
msgdata6
curad6
bodytagclassname6
di6
w6
id6
sans-seriffont-weight6
en-ca6
arial6
error6
fdbexp6
right6
left6
sign-in6
home6
undefined6
check6
date6
null6
has6
45
rain5
these5
uk5
1x15
typeof5
blur30px5
over5
may5
here5
locales5
meta5
need5
window5
ltime5
page5
save5
started5
up5
keep5
m5
positemconfclean5
d4
adcodeen-ca4
is3rd4
mast4
userprovideddata4
loaddefaultbundle4
adshowadshow4
tab4
win4
fdburl4
54
windowismodalopen4
slotdata4
aft24
labeladchoicesurlhttpsinfoyahoocomprivacycayahoorelevantadshtmlcloseclosecloseadclose4
adc4
adcollapsecollapsefdbi4
-wrap4
modlangbundlesexpanded4
mailboxesid4
fdb4
youll4
related4
newheight4
select4
positemhaserr4
view4
64
scale154
scalex-14
74
ymediamyappgetrapidtracker4
84
mathroundltime4
2px4
finance4
err4
low4
high4
next4
94
html4
documentgetelementsbytagnamebody04
their4
slotid4
en-us4
bodytag4
we4
find4
datrk4
do4
most4
down4
through4
less4
online4
her4
after4
sf4
ifmsgname4
bookid4
behavior4
104
mail4
nonexp4
adid4
default4
canadian4
hasexternal4
matchid4
servetype4
servetime4
cschtml4
rapidinstance4
increase4
ifwindowxzqdnullwindowxzqdnew4
facstatus4
cscuri4
creativeid4
placementid4
suppugc4
impid4
functiondata3
fori3
r3
yuiusenode-base3
functiony3
af-transport3
expiressetminutesexpiresgetminutes3
node3
windowafconfig3
type3
dategettime3
windowaf3
customers3
my3
location3
tell3
game3
ymediamyapp3
domain3
search3
pageparamsobject3
browser3
ymreqidymreqid3
later3
updates3
locationhostname3
mathrounddataaft3
afterpageload3
initialpageload3
300x2503
also3
said3
but3
fitness3
recent3
his3
barcelona3
luxury3
113
jobs3
greene3
set3
journey3
execution3
can3
president3
123
filter3
skip3
stay3
resourcetimingassets3
rapidconfig3
width3
0px3
press3
other3
could3
133
el3
needed3
they3
results3
make3
newwidth3
settimeoutfunction3
possize3
posid3
adindex3
origwidth3
origheight3
windowaddeventlistenerload3
windowremoveeventlistenerload3
windowaddeventlistener3
visible3
exp-push3
exp-ovr3
ymediaone3
curadclassnamereplaced-n3
143
nifwindowxzqdnullwindowxzqdnew3
9999999999999999999999993
153
there3
baby3
url3
ismonfetch3
hladscustom3
positemsize3
hladsall3
pslength3
pagemode3
functione3

What are the nameservers for yahoo.ca?

Yahoo.ca Domain Nameserver Information

HostIP AddressCountry
ns1.yahoo.com 68.180.131.16United States United States
ns2.yahoo.com 68.142.255.16United States United States
ns3.yahoo.com 203.84.221.53Hong Kong SAR China Hong Kong SAR China
ns5.yahoo.com 119.160.247.124Taiwan Taiwan
ns7.yahoo.com 68.142.226.82United States United States

Yahoo.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yahoo.ca is a scam?