Yahoo UK | News, email and search

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 334,680
Estimated Worth: $28,080

The trusted source of all the latest breaking news, sports, finance, entertainment and lifestyle stories.



Domain summary

Last updated
2021-03-22
Domain label
yahoo
Domain extension
co
Global Traffic Rank
334,680
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$28,080
Estimated daily income
$52
Estimated monthly income
$1,582

Rank summary

How is yahoo.co ranked relative to other sites:

Percentage of visits to yahoo.co from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Yahoo.co registered?
A: Yahoo.co was registered 3 weeks, 3 days, 7 hours, 42 minutes, 27 seconds ago on Monday, March 22, 2021.
Q: When was the WHOIS for Yahoo.co last updated?
A: The WHOIS entry was last updated 3 weeks, 3 days, 7 hours, 42 minutes, 27 seconds ago on Monday, March 22, 2021.
Q: What are Yahoo.co's nameservers?
A: DNS for Yahoo.co is provided by the following nameservers:
  • ns1.yahoo.com
  • ns2.yahoo.com
  • ns3.yahoo.com
  • ns5.yahoo.com
  • ns4.yahoo.com
Q: Who is the registrar for the Yahoo.co domain?
A: The domain has been registered at .CO Internet, S.A.S..
Q: What is the traffic rank for Yahoo.co?
A: Yahoo.co ranks 334,680 globally on Alexa. Yahoo.co has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Yahoo.co each day?
A: Yahoo.co receives approximately 4,621 visitors and 18,484 page impressions per day.
Q: What IP address does Yahoo.co resolve to?
A: Yahoo.co resolves to the IPv4 address 124.108.115.100.
Q: In what country are Yahoo.co servers located in?
A: Yahoo.co has servers located in the Singapore.
Q: What webserver software does Yahoo.co use?
A: Yahoo.co is powered by ATS webserver.
Q: Who hosts Yahoo.co?
A: Yahoo.co is hosted by Internet Content Provider in Singapore.
Q: How much is Yahoo.co worth?
A: Yahoo.co has an estimated worth of $28,080. An average daily income of approximately $52, which is roughly $1,582 per month.

Yahoo.co Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yahoo.co Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yahoo.co

H1 Headings

1 :
  1. Trending news - latest

H2 Headings

2 :
  1. Loud boom heard in four counties 'likely meteor'
  2. Coronavirus

H3 Headings

14 :
  1. Police breaking up party make startling discovery
  2. School asks parents not to wear 'skimpy' outfits
  3. Start preparing for next pandemic now PM warned
  4. How to boost your memory at work
  5. Cameron 'texted Sunak over COVID loans for failing bank'
  6. Tragedy as body of missing woman is found in Sussex woodland
  7. Europe doubles down on threat to block AstraZeneca exports to the UK
  8. Jeremy Clarkson calls Meghan Markle ‘silly little cable TV actress’ in defence of Piers Morgan
  9. EU rebuffs UK calls to ship AstraZeneca COVID vaccines from Europe
  10. ‘That p***ed him off’: Friend reveals what really annoyed Prince William after Verbier ski trip controversy
  11. ‘I don’t want sex with anyone’: the growing asexuality movement
  12. Ranked: 10 of the world's most beautiful buildings
  13. Weather
  14. Latest news and updates on the global coronavirus pandemic. Keep up-to-date on numbers of COVID-19 cases and deaths, analysis of the government's response, how the NHS is coping and other stories from the UK and around the world.

H4 Headings

2 :
  1. Trending Now
  2. London

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

31 :

Google Adsense

:
pub-7382640443023261

Google Analytics

:
Not Applicable

Links - Internal

53:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yahoo.co

adlrec3divclassnameifmsgnameif msgnameasexualitydocumentreferrertostringpositionweadtimeaft2difffunctionbodytagclassnamewindowlocationhostname syimgcom documentreferrertostringlrec4divymediamyappgetrapidtrackerrapidinstanceadidactionindexofadstartlrec3divparentelementclassnamefalse varcloudy todaydocumentgetelementsbyclassnameadsbygoogle0setattributedatapageurl pageurl adsbygooglecloudy0 lrec4divclassnamedont likeif yahoowhasadidactionindexofadstart 1if yahoo yahooi13nstoredontgetpanelcontrollershowindicatorselfconfigbadgehideclassresponseif posnamewindowperformance windowperformancenow varlrec4divclassnamecuradclassnamebodytag documentgetelementsbytagnamebody0 bodytagclassnamemon2nodeeuropeanorigheightelse4maxtimeoutprefetchyourthanks1x1adindexkeyvar wyaftconstantspanelloadingpositemconf positemconfcleanwindowperformance windowperformancenowwindowperformanceif typeof windowdarlalogrenderfailurepositemconfcleanpageparamsobjectincreaseif eventnamedocumentreferrertostring windowlocationtostring documentgetelementsbyclassnameadsbygoogle0setattributedatapageurlaftermoreone0 lrec3divclassnamewindowdarlalogrenderfailureposnamebodytag documentgetelementsbytagnamebody0adshowadshowif typeofcuradwindowperformancenowismon2validobjectdocumentgetelementsbytagnamebody0elementclassnamepositempositemhaserrparamstyletagpositemsize 1x1windowismodalopenviewnull ifvar ltimeadtimingwindowlocationtostring documentgetelementsbyclassnameadsbygoogle0setattributedatapageurl pageurlnew zealandfunctioneventnameymediahighnofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose adshowadshow adcollapsecollapsefdbiwindowlocationhostnamenofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclosedvar ltime windowperformancenowdarlaonreadynullwindowadsbygoogleitsmastwindowperformancenow varvar pageurleumathroundwindowperformancenowvisibleadsbygooglewindowlocationtostring documentgetelementsbyclassnameadsbygoogle0setattributedatapageurlclientconfigpageinfovaluepositemconfnewcountexpovrpanelvar w windowif lrec4divadtimetypeof windowdarlalogrenderfailurenumbernew dateshowbadgeparam objectwe askpreviousadwasmon2voidmakefalseexppushifltimeadcollapsecollapsefdbi dont likeadshowadshow adcollapsecollapsefdbi dontadidpositemmetaysizewindowperformancenow var ltimevar bodytagusaft2startrendervar bodytag documentgetelementsbytagnamebody0pageurl windowlocationhostname syimgcomyahoo yahooi13nnotsyimgcom documentreferrertostringvaccineswindowupdatespositemmetaltime windowperformancenowglobalselfsyimgcomukdocumentreferrertostring windowlocationtostringwindowlocationhostname syimgcomyouvar selfundefined varwperformancepslengthvalidaterequiredconfigswperformancenowtrueselfviewlowthanks for yourrenderdn ifadstarttimesettimeoutfunctionif windowperformancenativebillboardconfdarla nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose adshowadshowelementbodytagpageurlaft2 startorigwidthypossizedocumentgetelementbyidpositemconfclean ifw windowprincereturn void keytypeofpageurl windowlocationhostnamecffeedbackreturnnumbernewyahooi13nrapidinstancedocumentgetelementsbyclassnameadsbygoogle0setattributedatapageurl pageurlundefinedwilliamselfstorestylesisadposactionstartresetbadgednnewseventnamedarlatodaydocumentgetelementsbyclassnameadsbygoogle0setattributedatapageurlpositemsizemathroundltimebadgesopositionssyimgcom documentreferrertostring windowlocationtostringwindowlocationtostringpageurl adsbygoogle windowadsbygooglefunction if windowperformancedarla nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclosepositemhaserr positemsize 1x1astrazenecaposidadsbygoogle windowadsbygoogleaft2zealandconfigsposyahooi13ntypeof windowdarlalogrenderfailure functionif windowperformance windowperformancenow1 var12saidvarfunction ifenewheightnotificationsadactionafterpageload0documentgetelementbyidpositemconfcleanwindowdarlalogrenderfailure functionlikewhichladcollapsecollapsefdbivalue functionserviceif ismon2validmaincreatepanelparentnodevar pageurl windowlocationhostnamereturn voidcallchecklrec3divyahooconfig3datenofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose adshowadshowpositemhaserr positemsizenewyour feedbacklrecbgcolormissingdefaultcallbackgrowingpageurl adsbygoogledataeventoveradcollapsecollapsefdbi dontdefaultconfigelse ifmsgnamenewwidthsexrequiredadshowadshow adcollapsecollapsefdbivoid keytimeoutcallsassignhelpermethodsaskonlydocumentgetelementsbytagnamebody0 bodytagclassnamerefreshpanelnode

Longtail Keyword Density for Yahoo.co

KeywordsOccurences
if windowperformance windowperformancenow9
adshowadshow adcollapsecollapsefdbi dont7
adcollapsecollapsefdbi dont like7
thanks for your7
return void key6
var w window4
bodytag documentgetelementsbytagnamebody0 bodytagclassname4
var bodytag documentgetelementsbytagnamebody04
typeof windowdarlalogrenderfailure function3
if typeof windowdarlalogrenderfailure3
var ltime windowperformancenow3
windowperformancenow var ltime3
windowperformance windowperformancenow var3
positemhaserr positemsize 1x13
pageurl adsbygoogle windowadsbygoogle3
function if windowperformance3
documentgetelementsbyclassnameadsbygoogle0setattributedata-page-url pageurl adsbygoogle3
windowlocationtostring documentgetelementsbyclassnameadsbygoogle0setattributedata-page-url pageurl3
documentreferrertostring windowlocationtostring documentgetelementsbyclassnameadsbygoogle0setattributedata-page-url3
syimgcom documentreferrertostring windowlocationtostring3
windowlocationhostname syimgcom documentreferrertostring3
pageurl windowlocationhostname syimgcom3
var pageurl windowlocationhostname3
nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl-1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose adshowadshow adcollapsecollapsefdbi3
darla nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl-1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose adshowadshow3
if yahoo yahooi13n3
if windowperformance12
else if10
windowperformance windowperformancenow10
value function9
if typeof9
dont like8
return void7
adcollapsecollapsefdbi dont7
your feedback7
adshowadshow adcollapsecollapsefdbi7
var self6
void key6
-1 var5
d-n if5
yahoo yahooi13n4
ltime windowperformancenow4
bodytag documentgetelementsbytagnamebody04
var bodytag4
documentgetelementsbytagnamebody0 bodytagclassname4
var w4
numbernew date4
if yahoo4
null if4
w window4
undefined var4
documentgetelementsbyclassnameadsbygoogle0setattributedata-page-url pageurl3
darla nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl-1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose3
windowperformancenow var3
var ltime3
var pageurl3
if msgname3
nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl-1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose adshowadshow3
typeof windowdarlalogrenderfailure3
cloudy today3
0 lrec4divclassname3
windowdarlalogrenderfailure function3
new zealand3
param object3
adidactionindexofadstart -13
aft2 start3
0 lrec3divclassname3
if lrec4div3
pageurl adsbygoogle3
windowlocationhostname syimgcom3
adsbygoogle windowadsbygoogle3
false var3
windowlocationtostring documentgetelementsbyclassnameadsbygoogle0setattributedata-page-url3
documentreferrertostring windowlocationtostring3
function if3
syimgcom documentreferrertostring3
if eventname3
if ismon2valid3
positemhaserr positemsize3
positemsize 1x13
positemconf positemconfclean3
documentgetelementbyidpositemconfclean if3
if posname3
pageurl windowlocationhostname3
we ask3
var139
if124
function38
025
return23
else22
eventname19
true18
windowperformancenow16
new15
114
windowperformance13
your13
positem12
undefined12
typeof11
dont11
false10
key10
like9
value9
start9
aft29
posname9
callback8
null8
config8
yahoo8
not8
ad8
position8
curadclassname8
adcollapsecollapsefdbi7
lrec3divclassname7
yahooi13nrapidinstance7
d-n7
we7
feedback7
thanks7
27
1x17
adshowadshow7
window7
void7
ismon2valid6
self6
mathroundwindowperformancenow6
view6
pos6
aft2startrender6
has6
data6
f6
curad6
newcount6
pageurl6
darla6
lrec4divclassname6
object6
bodytagclassname6
ltime5
lrec3div5
yahooi13n5
lrec3divparentelementclassname5
astrazeneca5
get5
main5
adid5
wperformancenow5
adtime5
adaction5
msgname5
event5
timeout5
c5
selfstore4
increase4
newheight4
store4
lrec4div4
y4
w4
functioneventname4
positions4
element4
l4
windowismodalopen4
positemsize4
positemmeta4
positemmetaysize4
mathroundltime4
posid4
panel4
param4
resetbadge4
bodytag4
european4
one4
configs4
calls4
render4
ifmsgname4
required4
date4
numbernew4
vaccines4
maxtimeout4
notifications4
so4
rapidinstance4
more4
34
ymediamyappgetrapidtracker4
after4
clientconfigpageinfo4
adtimeaft2diff4
its4
only4
documentgetelementsbytagnamebody04
yaft4
missing4
afterpageload3
pageparamsobject3
isadposaction3
lrec-bgcolor3
adstarttime3
visible3
adidactionindexofadstart3
origheight3
call3
windowdarlalogrenderfailure3
exp-ovr3
e3
exp-push3
prefetch3
origwidth3
elementclassname3
newwidth3
settimeoutfunction3
adtiming3
possize3
adindex3
wperformance3
response3
styletag3
previousadwasmon23
check3
sex3
createpanelparentnode3
us3
which3
eu3
prince3
william3
refreshpanelnode3
growing3
said3
uk3
make3
assignhelpermethods3
zealand3
validaterequiredconfigs3
defaultconfig3
over3
43
default3
you3
news3
constantspanelloading3
showbadge3
showindicator3
selfconfigbadgehideclass3
badge3
asexuality3
selfview3
mon2node3
d3
service3
mast3
documentgetelementbyidpositemconfclean3
positemconfclean3
positemconf3
ymedia3
positemhaserr3
styles3
pslength3
global3
updates3
darlaonready3
nativebillboardconf3
cloudy3
windowadsbygoogle3
adsbygoogle3
documentgetelementsbyclassnameadsbygoogle0setattributedata-page-url3
windowlocationtostring3
documentreferrertostring3
syimgcom3
windowlocationhostname3
panelcontroller3
nofacstatusfacrotationhasexternal0size300x250bookid19693559servetype0ttl-1slotid0fdbnullslotdatatrustedcustomfalsefreqcappedfalsedelivery1pacing1expires41133009companionfalseexclusivefalseredirecttruepvidvljtadeyny6ggtmnyff8mgd2mzuumqaaaacmakhjadclabeladchoicesurlhttpsinfoyahoocomprivacyukyahoorelevantadshtmlcloseclosecloseadclose3
low3
high3
today3
ask3

Who hosts Yahoo.co?

Yahoo.co Hosting Provider Information

Hosted IP Address:124.108.115.100
Hosted Hostname:w2.src.vip.tw1.yahoo.com
Service Provider:Internet Content Provider
Hosted Country:SingaporeSG
Location Latitude:1.3667
Location Longitude:103.8
Webserver Software:ATS

Is "Internet Content Provider" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
internet content provider
0.0004%

HTTP Header Analysis for Yahoo.co

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Mon, 22 Mar 2021 02:08:46 GMT
p3p: policyref="https://policies.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
cache-control: no-store, no-cache, max-age=0, private
strict-transport-security: max-age=31536000
accept-ch: device-memory, dpr, width, viewport-width, rtt, downlink, ect
accept-ch-lifetime: 604800
x-xss-protection: 1; mode=block
content-encoding: gzip
x-content-type-options: nosniff
content-type: text/html; charset=UTF-8
x-envoy-upstream-service-time: 10
server: ATS
Age: 0
Transfer-Encoding: chunked
Connection: keep-alive
Expires: -1
Content-Security-Policy: sandbox allow-forms allow-same-origin allow-scripts allow-popups allow-popups-to-escape-sandbox allow-presentation; report-uri https://csp.yahoo.com/beacon/csp?src=ats&site=frontpage®ion=GB&lang=en-GB&device=desktop&yrid=cvjvk29g5fv1e&partner=; frame-ancestors 'self' https://*.techcrunch.com https://*.yahoo.com https://*.aol.com https://*.huffingtonpost.com https://*.oath.com https://*.search.yahoo.com https://*.search.aol.com https://*.search.huffpost.com htts://*.verizonmedia.com https://*.publishing.oath.com
Expect-CT: max-age=31536000, report-uri="http://csp.yahoo.com/beacon/csp?src=yahoocom-expect-ct-report-only"
Referrer-Policy: no-referrer-when-downgrade

Yahoo.co Domain Nameserver Information

HostIP AddressCountry
ns1.yahoo.com 68.180.131.16
ns2.yahoo.com 68.142.255.16
ns3.yahoo.com 27.123.42.42
ns5.yahoo.com 202.165.97.53
ns4.yahoo.com 98.138.11.157


Need to find out who hosts Yahoo.co?


Domain Registration (WhoIs) information for Yahoo.co

 Number of allowed queries exceeded. 

Websites with Similar Names

Recently Updated Websites

Ashdownload.com (1 second ago.)130972.com (3 seconds ago.)Theicingcakes.com (3 seconds ago.)Klqmyy7-liquidwebsites.com (3 seconds ago.)Rjpastore.com (3 seconds ago.)Adventurersclub.org (4 seconds ago.)Gennakerventures.com (4 seconds ago.)Campalbizu.com (4 seconds ago.)Cbdsnow.org (4 seconds ago.)Timereborn.com (4 seconds ago.)Mockingbirdmanor.com (4 seconds ago.)Eudaldbonfill.com (5 seconds ago.)Playercube.com (5 seconds ago.)Sujinc.com (5 seconds ago.)Generationalway.com (5 seconds ago.)Darkquantnet.com (5 seconds ago.)Carolwilsoncpa.com (5 seconds ago.)Addictionrehabnashvilletn.com (5 seconds ago.)Brazosvalleyequipment.com (5 seconds ago.)Pregelmiddle-east.com (5 seconds ago.)Rainstrat.com (5 seconds ago.)Jadestreetgallery.com (5 seconds ago.)Vietortho.com (5 seconds ago.)Blogingly.com (6 seconds ago.)Angryhuman.online (6 seconds ago.)Kdvmh4d.com (6 seconds ago.)Trust-changer.com (6 seconds ago.)Benaroyapictures.com (6 seconds ago.)Techvaluelabs.com (7 seconds ago.)Qualitypersepectivecustombuilders.com (7 seconds ago.)

Recently Searched Keywords

services like (1 second ago.)modernthemes.net (2 seconds ago.)clerk (5 seconds ago.)мощные ssd vds (6 seconds ago.)san marco per (9 seconds ago.)fox river trail (11 seconds ago.)孵化包装hatching&packaging (11 seconds ago.)bookdepository hk (12 seconds ago.)dns graph online (15 seconds ago.)gotopbtn (16 seconds ago.)day to day dubai (16 seconds ago.)texas holdem (17 seconds ago.)кондиционеры мобильние и оконные (19 seconds ago.)modigliani miller proposition 1 och 2 svenska (20 seconds ago.)sports roundup (21 seconds ago.)подробнее (21 seconds ago.)presidential election 2020 live results (21 seconds ago.)aristarco dishwasher (22 seconds ago.)anther function (23 seconds ago.)хмельницький-виставка  (24 seconds ago.)ca vit (25 seconds ago.)tweet unavailable wbqpushfunction (26 seconds ago.)480p 400mb (27 seconds ago.)turn facebook profile into page (28 seconds ago.)nhiu1ec7t ngu00e0y hu00e8 (29 seconds ago.)destocki oct (29 seconds ago.)patrick j (29 seconds ago.)iwa (31 seconds ago.)お友達紹介制度 (31 seconds ago.)aceleramos seu site wordpress (32 seconds ago.)