Yahoo UK | News, email and search

Safety: Low trust score
Year Founded: before Aug
Global Traffic Rank: 19,022
Estimated Worth: $752,400

The trusted source of all the latest breaking news, sports, finance, entertainment and lifestyle stories.



Domain summary

Last updated
2020-10-24
Domain label
yahoo
Domain extension
co.uk
Domain registered:
before Aug-1996
Domain updated:
05-Feb-2020
Domain expires:
2020-07-18
Global Traffic Rank
19,022
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$752,400
Estimated daily income
$1,045
Estimated monthly income
$31,785

Rank summary

How is yahoo.co.uk ranked relative to other sites:

Percentage of visits to yahoo.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Yahoo.co.uk registered?
A: Yahoo.co.uk was registered before Aug-1996 on Thursday, January 1, 1970.
Q: When was the WHOIS for Yahoo.co.uk last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 1 week, 3 days, 8 hours, 15 minutes, 38 seconds ago on Wednesday, February 5, 2020.
Q: What are Yahoo.co.uk's nameservers?
A: DNS for Yahoo.co.uk is provided by the following nameservers:
  • ns1.yahoo.com
  • ns3.yahoo.com
  • ns4.yahoo.com
  • ns5.yahoo.com
Q: Who is the registrar for the Yahoo.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Yahoo.co.uk?
A: Yahoo.co.uk ranks 19,022 globally on Alexa. Yahoo.co.uk has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Yahoo.co.uk each day?
A: Yahoo.co.uk receives approximately 87,099 visitors and 522,594 page impressions per day.
Q: What IP address does Yahoo.co.uk resolve to?
A: Yahoo.co.uk resolves to the IPv4 address 74.6.144.139.
Q: In what country are Yahoo.co.uk servers located in?
A: Yahoo.co.uk has servers located in the United States.
Q: What webserver software does Yahoo.co.uk use?
A: Yahoo.co.uk is powered by ATS webserver.
Q: Who hosts Yahoo.co.uk?
A: Yahoo.co.uk is hosted by Yahoo! in United States.
Q: How much is Yahoo.co.uk worth?
A: Yahoo.co.uk has an estimated worth of $752,400. An average daily income of approximately $1,045, which is roughly $31,785 per month.

Yahoo.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yahoo.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yahoo.co.uk

H1 Headings

1 :
  1. Trending news - latest

H2 Headings

2 :
  1. London's rate of coronavirus infection creeps up
  2. Coronavirus

H3 Headings

14 :
  1. Miss Swimsuit UK's 'title stripped after BLM rant'
  2. Clarkson offers to pay for boy's stolen goods
  3. The Chase’s Anne Hegerty opens up about being in debt
  4. Swarm of flying ants 50 miles wide spotted from space
  5. How to stop your glasses steaming up with a mask on
  6. Gareth Bale's awkward celebrations during Real Madrid title win has fans in hysterics
  7. Here's Why You Shouldn't Wear A Mask With A Valve
  8. It's all over. America has lost its battle with coronavirus
  9. Bella Hadid looks unreal in new Calvin Klein campaign
  10. Strictly's James Jordan says his heart is broken as he reveals devastating news
  11. Miss Swimsuit UK winner Jasmine Archer-Jones 'has title stripped after rant about Black Lives Matter on Facebook'
  12. Video 'We Ain’t Shopping at Starbucks No More': Seattle Protesters Call for Boycott
  13. Weather
  14. Latest news and updates on the global coronavirus pandemic. Keep up-to-date on numbers of COVID-19 cases and deaths, analysis of the government's response, how the NHS is coping and other stories from the UK and around the world.

H4 Headings

2 :
  1. Trending Now
  2. London

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

30:

Links - Internal (nofollow)

0:

Links - Outbound

35:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yahoo.co.uk

autonwdreplacement13 f 106whichtypeof windowdarlalogrenderfailurenewsserviceadmaxvars nbrxdsectionid 239808051nbrxdpublisheridparam objectgroup has 1rayner3nybkt ukplayer02nusprivacy nwddfori in cdiescapecireturnselfconfigbadgehideclassexclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinningcontractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning groupnumbernew datebodytag documentgetelementsbytagnamebody0 bodytagclassnameexclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinningactivexobjectmicrosoftxmlhttpfunctionk0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return 1returnadactionukplayer02nusprivacypanelyahooif msgnamepositemmetaypositemhaserrif windowperformance windowperformancenowpositionsmaxtimeoutaft2 start3nybkt ukplayer02nusprivacyif typeofaskadspositionslrecrule0wintypeexclusivegroup1noteswinning group hasadserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunction admaxadclientvarlrec3divclassnamefgetsdiffdsdfvar enewif ismon2validbelsecreatecookienexagesd1001return 1return nullnvarhthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar paramsfunctionadmaxadcallbackparamsuanavigatoruseragentparamsofjsvarrendershowbadge1return nullnvar suidpositemconf positemconfcleanadspositionslrecrule0wintypeexclusivegroup1noteswinningbmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvarstylesapiurlhttpsoaojstagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunctiongetsuidnvarbmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividforivar ltimenoreadcookiecifdocumentcookievar jcvar gdocumentcookiesplitforvarvar w windowcatchapiurlhttpsoaojstagonemobileyahoocomadmaxadmaxapidovararecookiesenabledvarmsgnamehttpsukyahoocomnsecure 1nbrxdsiteidexclusive adspositionslrecrule0wintypeexclusivegroup1noteswinningpageparamsobjectghiescapegireturn0f 106afterencodeparamscvar dforixdomainrequestelsereturn new xmlhttprequestelsereturnadmaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavardocumentgetelementbyidpositemconfcleanif windowperformancepositemwindowdarlalogrenderfailure functionpreviousadwasmon2lrec4divif posnamecheckadmaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvarsoadspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group hasxdomainrequestundefinedreturn newddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividforiadserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunctiongdocumentcookiesplitforvarmathroundltimecdiescapecireturn51enew admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof239808051nbrxdpublisherid 20459933223nypubblobrequiredcuradvar ltime windowperformancenownull iforigwidthrurlif typeof windowdarlalogrenderfailureafterpageloadfunctionltimenewheightmpcreatepanelparentnodepositemsize 1x11 varismon2validexclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning groupconfigfalseaft2startrender1 exclusive4data4452051ndcn brxd4452051nyadpossettimeoutfunctionadmaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvarfunction if windowperformancedfunction logbfunction arecookiesenabledvaradspositionslrecrule0wintypeexclusivegroup1noteswinning groupegetparamsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvarathisbuildrequesturladserveurldthisrenderadavarpos1 exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinningresponsegetsuidnvar admaxvars nbrxdsectionid1nbrxdsiteid 4452051ndcn brxd4452051nyadposfunction ifif eventnameyahoo yahooi13nrefreshpanelnodekscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar1 exclusive adspositionslrecrule0wintypeexclusivegroup1noteswinningcanreturn voidbadgvarwindowperformance windowperformancenow varparamadtimeaft2diffxdomainrequestundefinedreturn new xdomainrequestelsereturnadcollapsecollapsefdbi dontjcvarvisiblecontractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinningreadcookiecifdocumentcookievarreturn void keyfunctioneventnameadidn ifwindowcallxmlhttprequestelsereturnreplacement for exclusive20459933223nypubblobpositemhaserr positemsizeadmaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvarvoid keybmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavaradmaxadclientvarnbrxdsectionidlrecbgcolorgetsuidnvar admaxvarscgetsdifcparamssdcvar dnewhttpsukyahoocomnsecurewperformanceenew admaxadclientegetaddfunction1nbrxdsiteid 4452051ndcnfgetsdiffdsdfvar enew admaxadclientegetaddfunctionincludejscjdvarnew xmlhttprequestelsereturncdiescapecireturn dfunctionconfigsddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvardforipositemsizewe askarecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunctionaft26admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturnarecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeofobjectusenullnvarnumbernewkscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar dforinbrxdsectionid 239808051nbrxdpublisheridpslengthif yahoomastnativebillboardconf1x1bodytagclassnamecallbackadindexdfunctionundefinedtypeof windowdarlalogrenderfailure functionresetbadgeupdatesfgetsdiffdsdfvarif13 fnullnvar suidxdomainrequestelsereturn newgmathfloormathrandom1000000var badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunctionwindowismodalopendatesuid getsuidnvarlikehas 1navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunctiontimeoutbodytag documentgetelementsbytagnamebody0youdfunction logbfunctionadshowadshow adcollapsecollapsefdbi dontheightnullhas 1 exclusive1nbrxdsiteid1return nullnvarrapidinstanceparamsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvarenewpanelcontrolleryahooi13nrapidinstancebadgestorenewwidthlowincludejscjdvar gmathfloormathrandom1000000var badgvardont likewindowperformanceclientconfigpageinfoexclusive adspositionslrecrule0wintypeexclusivegroup1noteswinning groupbelsecreatecookienexagesd1001return3groupadmaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvardefaultconfigactivexobjectmicrosoftxmlhttpfunction includejscjdvar gmathfloormathrandom1000000varnotificationswperformancenowconstantspanelloadingif lrec4divgroup hasadcollapsecollapsefdbicdiescapecireturn dfunction logbfunctionactivexobjectmicrosoftxmlhttpfunction includejscjdvarhactagthisdividforiselfvieweventnameadcollapsecollapsefdbi dont likenew xdomainrequestelsereturnjcvar gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001returnadmaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar enewelseifmsgnamevar selfxdomainrequestelsereturncuradclassnamepositemconfcleancontractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning group hasvalueadsconfiggetxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturnadmaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar dnewbadgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction3nybktadidactionindexofadstart 1admaxaddduanavigatoruseragentdofjsvargdocumentcookiesplitforvar k0k10return0createcookienexagesdb001returntypeoflondonwindowperformancenow var ltimefdnltime windowperformancenownullnvar suid getsuidnvartodaycatch epossizehthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavardarlaxmlhttprequestelsereturn new activexobjectmicrosoftxmlhttpfunctionnewjcvar gdocumentcookiesplitforvaradshowadshowcgetsdifcparamssdcvarukplayer02nusprivacy nwdlogbfunction arecookiesenabledvaradspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning groupbadgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvarghiescapegireturn hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavarymediapositemconf0 lrec3divclassnamenew xdomainrequestelsereturn newtruek0k10return0createcookienexagesdb001returnhigh of 13navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction readcookiecifdocumentcookievar jcvarathisbuildrequesturladserveurldthisrenderadavar paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvarcgetsdifcparamssdcvar dnew admaxclientdadmaxadparamsfunctionlrec3divlsuidadtimeadmaxvars nbrxdsectionidadidadmaxclientdadmaxadparamsfunctionvalue functionkscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunctionadshowadshow adcollapsecollapsefdbihiswindowperformancenow varexclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning groupnew activexobjectmicrosoftxmlhttpfunction includejscjdvarassignhelpermethodsdocumentgetelementbyidpositemconfclean ifonlyadspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinningdcadserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunction admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavareventvalidaterequiredconfigshighbnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunctionif yahoo yahooi13npositionxdomainrequestundefinedreturnorigheightwelogbfunction arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeofwindowperformance windowperformancenowdnew admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvarreadcookiecifdocumentcookievar jcvarlogbfunctionposnamebodytagpositemmetaysizegetxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn newvar wghiescapegireturn hthisgetadfunctiondvarundefined varadmaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeofwindowdarlalogrenderfailuremathroundwindowperformancenowstyletagbeingadidactionindexofadstart2nbrxdsectionid 239808051nbrxdpublisherid 20459933223nypubblob4452051ndcnadtimingadstarttimegmathfloormathrandom1000000var badgvarw windowpositemhaserr positemsize 1x1notexppushincreasewlrec4divclassnamenew xmlhttprequestelsereturn newdocumentgetelementsbytagnamebody0k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001returnnavigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction readcookiecifdocumentcookievarsuid getsuidnvar admaxvars1returndontglobalgmathfloormathrandom1000000var0 lrec4divclassnamenew activexobjectmicrosoftxmlhttpfunctionhttpsukyahoocomnsecure 1nbrxdsiteid 4452051ndcnadmaxvarsitsstartapiurlhttpsoaojstagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunction admaxadclientvarwindowperformancenowf 106 cviewisadposactionathisbuildrequesturladserveurldthisrenderadavar paramsfunctionhasvar bodytagincludejscjdvar gmathfloormathrandom1000000varadmaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvarexclusivednew admaxclientdadmaxadparamsfunctionvar bodytag documentgetelementsbytagnamebody0encodeparamscvaryaftexpovrbnavigatorcookieenabledtruefalseiftypeofhactagthisdividfori in ghiescapegireturn106 cparamsfunctiondnewymediamyappgetrapidtrackerkeyvar239808051nbrxdpublisheridxmlhttprequestelsereturn newposidgetxmlhttprequestifwindowxmlhttprequestiftypeofadmaxadclientegetaddfunctiondarlaonreadyyourlrec3divparentelementclassnameelse ifnewcountselfstorebrxd4452051nyadposgdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001returnshowindicatorhthisgetadfunctiondvaradmainbnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction readcookiecifdocumentcookievaryahooi13nselfreturnbelsecreatecookienexagesd1001return 1returndocumentgetelementsbytagnamebody0 bodytagclassnamevoid

Longtail Keyword Density for Yahoo.co.uk

KeywordsOccurences
group has 112
has 1 exclusive12
if windowperformance windowperformancenow9
adcollapsecollapsefdbi dont like7
adshowadshow adcollapsecollapsefdbi dont7
return void key6
k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return 1return4
dfori in cdiescapecireturn4
xdomainrequestundefinedreturn new xdomainrequestelsereturn4
new xdomainrequestelsereturn new4
xdomainrequestelsereturn new xmlhttprequestelsereturn4
new xmlhttprequestelsereturn new4
new activexobjectmicrosoftxmlhttpfunction includejscjdvar4
activexobjectmicrosoftxmlhttpfunction includejscjdvar gmathfloormathrandom1000000var4
includejscjdvar gmathfloormathrandom1000000var badgvar4
gmathfloormathrandom1000000var badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction4
badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar4
kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar dfori4
cdiescapecireturn dfunction logbfunction4
var w window4
dfunction logbfunction arecookiesenabledvar4
logbfunction arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof4
admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn4
bodytag documentgetelementsbytagnamebody0 bodytagclassname4
arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction4
bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction readcookiecifdocumentcookievar4
navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction readcookiecifdocumentcookievar jcvar4
readcookiecifdocumentcookievar jcvar gdocumentcookiesplitforvar4
jcvar gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return4
gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return4
var bodytag documentgetelementsbytagnamebody04
getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn new4
xmlhttprequestelsereturn new activexobjectmicrosoftxmlhttpfunction4
enew admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof4
bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividfori4
fgetsdiffdsdfvar enew admaxadclientegetaddfunction4
1 exclusive adspositionslrecrule0wintypeexclusivegroup1noteswinning4
exclusive adspositionslrecrule0wintypeexclusivegroup1noteswinning group4
adspositionslrecrule0wintypeexclusivegroup1noteswinning group has4
1 exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4
exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group4
adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group has4
adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar4
admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar4
apiurlhttpsoao-js-tagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction admaxadclientvar4
hactagthisdividfori in ghiescapegireturn4
cgetsdifcparamssdcvar dnew admaxclientdadmaxadparamsfunction4
admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar enew4
ghiescapegireturn hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar4
dnew admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar4
admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar4
admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar dnew4
paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar4
athisbuildrequesturladserveurldthisrenderadavar paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar4
hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar paramsfunction4
typeof windowdarlalogrenderfailure function3
exclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning group3
if typeof windowdarlalogrenderfailure3
13 f -1063
f -106 c3
var ltime windowperformancenow3
windowperformancenow var ltime3
windowperformance windowperformancenow var3
positemhaserr positemsize 1x13
replacement for exclusive3
function if windowperformance3
contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning group has3
3nybkt ukplayer02nusprivacy nwd3
1nbrxdsiteid 4452051ndcn brxd4452051nyadpos3
httpsukyahoocomnsecure 1nbrxdsiteid 4452051ndcn3
nbrxdsectionid 239808051nbrxdpublisherid 20459933223nypubblob3
admaxvars nbrxdsectionid 239808051nbrxdpublisherid3
getsuidnvar admaxvars nbrxdsectionid3
suid getsuidnvar admaxvars3
nullnvar suid getsuidnvar3
1return nullnvar suid3
belsecreatecookienexagesd1001return 1return nullnvar3
high of 133
if yahoo yahooi13n3
if windowperformance12
group has12
1 exclusive12
has 112
windowperformance windowperformancenow10
else if9
value function9
if typeof9
dont like8
adcollapsecollapsefdbi dont7
adshowadshow adcollapsecollapsefdbi7
return void7
void key6
var self6
badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction4
readcookiecifdocumentcookievar jcvar4
navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction readcookiecifdocumentcookievar4
activexobjectmicrosoftxmlhttpfunction includejscjdvar4
bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction4
arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof4
logbfunction arecookiesenabledvar4
kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar4
dfunction logbfunction4
includejscjdvar gmathfloormathrandom1000000var4
gmathfloormathrandom1000000var badgvar4
gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return4
encodeparamscvar dfori4
jcvar gdocumentcookiesplitforvar4
null if4
k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return4
belsecreatecookienexagesd1001return 1return4
var w4
w window4
xmlhttprequestelsereturn new4
function if4
-1 var4
d-n if4
ltime windowperformancenow4
var bodytag4
bodytag documentgetelementsbytagnamebody04
documentgetelementsbytagnamebody0 bodytagclassname4
numbernew date4
if yahoo4
yahoo yahooi13n4
new activexobjectmicrosoftxmlhttpfunction4
cdiescapecireturn dfunction4
new xmlhttprequestelsereturn4
athisbuildrequesturladserveurldthisrenderadavar paramsfunction4
apiurlhttpsoao-js-tagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction4
adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group4
exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4
adspositionslrecrule0wintypeexclusivegroup1noteswinning group4
undefined var4
exclusive adspositionslrecrule0wintypeexclusivegroup1noteswinning4
admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar4
bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar4
ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividfori4
xdomainrequestelsereturn new4
hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar4
ghiescapegireturn hthisgetadfunctiondvar4
paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar4
fgetsdiffdsdfvar enew4
new xdomainrequestelsereturn4
xdomainrequestundefinedreturn new4
getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn4
admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof4
admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar4
enew admaxadclientegetaddfunction4
admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar4
admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar4
dnew admaxclientdadmaxadparamsfunction4
cgetsdifcparamssdcvar dnew4
adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction admaxadclientvar4
0 lrec4divclassname3
if lrec4div3
0 lrec3divclassname3
windowperformancenow var3
var ltime3
param object3
contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning group3
if msgname3
exclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning3
-106 c3
f -1063
typeof windowdarlalogrenderfailure3
windowdarlalogrenderfailure function3
13 f3
adidactionindexofadstart -13
aft2 start3
if ismon2valid3
catch e3
if posname3
httpsukyahoocomnsecure 1nbrxdsiteid3
1return nullnvar3
nullnvar suid3
suid getsuidnvar3
getsuidnvar admaxvars3
admaxvars nbrxdsectionid3
nbrxdsectionid 239808051nbrxdpublisherid3
239808051nbrxdpublisherid 20459933223nypubblob3
1nbrxdsiteid 4452051ndcn3
documentgetelementbyidpositemconfclean if3
4452051ndcn brxd4452051nyadpos3
3nybkt ukplayer02nusprivacy3
ukplayer02nusprivacy nwd3
if eventname3
positemhaserr positemsize3
positemsize 1x13
positemconf positemconfclean3
we ask3
var131
if122
function40
new25
024
return23
else21
119
eventname18
true18
undefined17
has17
windowperformancenow16
exclusive15
like13
213
windowperformance13
typeof12
group12
positem12
false11
key11
yahoo10
start9
dont9
posname9
null9
ad9
value9
aft29
your9
window9
after8
curadclassname8
suid8
config8
f8
callback8
position8
adshowadshow7
lrec3divclassname7
1x17
c7
void7
adcollapsecollapsefdbi7
yahooi13nrapidinstance7
view6
mathroundwindowperformancenow6
bodytagclassname6
object6
self6
data6
aft2startrender6
newcount6
event6
ismon2valid6
curad6
we6
lrec4divclassname6
darla5
store5
get5
d-n5
lrec3div5
ltime5
enew5
lrec3divparentelementclassname5
yahooi13n5
adid5
timeout5
adaction5
main5
positions5
wperformancenow5
you5
pos5
msgname5
adtime5
badgvar4
e4
bnavigatorcookieenabledtruefalseiftypeof4
encodeparamscvar4
dfori4
cdiescapecireturn4
dfunction4
logbfunction4
arecookiesenabledvar4
navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction4
admaxvars4
readcookiecifdocumentcookievar4
jcvar4
kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction4
k0k10return0createcookienexagesdb001return4
belsecreatecookienexagesd1001return4
1return4
gdocumentcookiesplitforvar4
posid4
w4
bodytag4
yaft4
adtimeaft2diff4
ymediamyappgetrapidtracker4
rapidinstance4
date4
numbernew4
maxtimeout4
clientconfigpageinfo4
documentgetelementsbytagnamebody04
ifmsgname4
functioneventname4
increase4
newheight4
y4
windowismodalopen4
mathroundltime4
lrec4div4
positemmetaysize4
positemmeta4
positemsize4
l4
gmathfloormathrandom1000000var4
includejscjdvar4
activexobjectmicrosoftxmlhttpfunction4
configs4
adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4
adspositionslrecrule0wintypeexclusivegroup1noteswinning4
low4
high4
adi4
xmlhttprequestelsereturn4
call4
mp4
required4
adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction4
notifications4
34
resetbadge4
render4
selfstore4
updates4
param4
panel4
not4
apiurlhttpsoao-js-tagonemobileyahoocomadmaxadmaxapidovar4
its4
paramsfunction4
admaxadclientegetaddfunction4
dnew4
athisbuildrequesturladserveurldthisrenderadavar4
hthisgetadfunctiondvar4
ghiescapegireturn4
admaxclientdadmaxadparamsfunction4
hactagthisdividfori4
ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar4
cgetsdifcparamssdcvar4
fgetsdiffdsdfvar4
bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar4
admaxaddduanavigatoruseragentdofjsvar4
admaxadcallbackparamsuanavigatoruseragentparamsofjsvar4
xdomainrequestundefinedreturn4
admaxadclientvar4
xdomainrequestelsereturn4
getxmlhttprequestifwindowxmlhttprequestiftypeof4
isadposaction3
showindicator3
pageparamsobject3
visible3
showbadge3
exp-push3
exp-ovr3
badge3
news3
use3
origheight3
origwidth3
no3
newwidth3
settimeoutfunction3
selfconfigbadgehideclass3
adidactionindexofadstart3
afterpageload3
adstarttime3
global3
styles3
wperformance3
panelcontroller3
adtiming3
adsconfig3
selfview3
styletag3
createpanelparentnode3
refreshpanelnode3
service3
only3
constantspanelloading3
so3
response3
windowdarlalogrenderfailure3
239808051nbrxdpublisherid3
possize3
getsuidnvar3
43
height3
auto3
replacement3
contractexclusionstatuseffectiveconfigurationbuckethandle2023392312ukhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392312enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbackfalsepriorityfalsereplacedmastmonmon2winnersgroup1noteswinning3
darlaonready3
d3
nativebillboardconf3
catch3
today3
rurl3
nbrxdsectionid3
nwd3
ukplayer02nusprivacy3
3nybkt3
brxd4452051nyadpos3
4452051ndcn3
1nbrxdsiteid3
httpsukyahoocomnsecure3
53
pslength3
adindex3
his3
63
20459933223nypubblob3
defaultconfig3
validaterequiredconfigs3
being3
lrec-bgcolor3
assignhelpermethods3
previousadwasmon23
check3
mast3
nullnvar3
documentgetelementbyidpositemconfclean3
positemconfclean3
positemconf3
ymedia3
can3
rayner3
positemhaserr3
which3
london3
ask3

Who hosts Yahoo.co.uk?

Yahoo.co.uk Hosting Provider Information

Hosted IP Address:74.6.144.139
Hosted Hostname:media-router1.prod.media.vip.bf1.yahoo.com
Service Provider:Yahoo!
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:ATS

Is "Yahoo!" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Yahoo!
0.0759%

HTTP Header Analysis for Yahoo.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 24 Oct 2020 05:34:17 GMT
Connection: keep-alive
Server: ATS
Cache-Control: no-store, no-cache
Content-Type: text/html
Content-Language: en
Content-Security-Policy: frame-ancestors 'self' https://*.techcrunch.com https://*.yahoo.com https://*.aol.com https://*.huffingtonpost.com https://*.oath.com https://*.verizonmedia.com https://*.publishing.oath.com https://*.autoblog.com; sandbox allow-forms allow-same-origin allow-scripts allow-popups allow-popups-to-escape-sandbox allow-presentation allow-downloads; report-uri https://csp.yahoo.com/beacon/csp?src=ats&site=frontpage®ion=GB&lang=en-GB&device=desktop&yrid=&partner=;
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; report="https://csp.yahoo.com/beacon/csp?src=fp-hpkp-uk"
Location: https://uk.yahoo.com/
Content-Length: 8

Yahoo.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.yahoo.com 68.180.131.16
ns3.yahoo.com 27.123.42.42
ns4.yahoo.com 98.138.11.157
ns5.yahoo.com 202.165.97.53


Need to find out who hosts Yahoo.co.uk?


Domain Registration (WhoIs) information for Yahoo.co.uk

 Domain name:
yahoo.co.uk

Data validation:
Nominet was not able to match the registrant's name and/or address against a 3rd party source on 20-Dec-2017

Registrar:
Markmonitor Inc. t/a MarkMonitor Inc. [Tag = MARKMONITOR]
URL: http://www.markmonitor.com

Relevant dates:
Registered on: before Aug-1996
Expiry date: 09-Mar-2021
Last updated: 05-Feb-2020

Registration status:
Registered until expiry date.

Name servers:
ns1.yahoo.com
ns3.yahoo.com
ns4.yahoo.com
ns5.yahoo.com

WHOIS lookup made at 20:12:41 28-Aug-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Recently Updated Websites

Yajing164.com (1 second ago.)Ahdwallpaperswide.com (1 second ago.)Doctorxavierpelfort.com (2 seconds ago.)Highpotentialleadercourse.com (2 seconds ago.)Temple.work (2 seconds ago.)Consultantsondemandllc.com (2 seconds ago.)Lovemeasiamthebook.com (2 seconds ago.)Alahmari.net (3 seconds ago.)Bricetbroc.com (4 seconds ago.)Chapmanhonda.com (4 seconds ago.)Ignacioarana.com (5 seconds ago.)Znxinxi.com (5 seconds ago.)Persuadelikemagic.com (5 seconds ago.)Corresmx.com (5 seconds ago.)Winline15.com (5 seconds ago.)Fatradedxb.com (5 seconds ago.)Dd9888.com (6 seconds ago.)Kidsforsaferamerica.com (6 seconds ago.)Companyformationireland.com (6 seconds ago.)Laser506.com (7 seconds ago.)Oakstoneconsulting.com (7 seconds ago.)Mathieutabory.com (7 seconds ago.)Carport-solaire.com (7 seconds ago.)Squarte.site (7 seconds ago.)Superkala.online (7 seconds ago.)Dp-wt.site (7 seconds ago.)Qingyiqian.com (7 seconds ago.)Lygatsh.com (7 seconds ago.)Lifeinstride.org (7 seconds ago.)Bingoforum.dk (8 seconds ago.)

Recently Searched Keywords

klasrler (1 second ago.)bc vo con (1 second ago.)更新至16集 (2 seconds ago.)logros (5 seconds ago.)asesoría fiscal y contable (6 seconds ago.)đau bụng dưới rốn là dấu hiệu của bệnh lý gì, có nguy hiểm không (7 seconds ago.)эп (7 seconds ago.)kiwicool tricycle (8 seconds ago.)800 2354272 (8 seconds ago.)nai visual (9 seconds ago.)lauren ko (11 seconds ago.)free tube (12 seconds ago.)atcc (12 seconds ago.)品质工程师(qe) (12 seconds ago.)beforesend (16 seconds ago.)foosballvietnam.com (18 seconds ago.)alfanak code (19 seconds ago.)1907. магазины «товарищества и. д. сытина и к» (20 seconds ago.)if attachmentsif attachmentslengthifif (21 seconds ago.)forklift (24 seconds ago.)august ash (24 seconds ago.)atcc strains (25 seconds ago.)cuál es tu color de pelo (26 seconds ago.)mooji (27 seconds ago.)annuity (28 seconds ago.)guide meaning (30 seconds ago.)atcco (31 seconds ago.)common daisy  (32 seconds ago.)aquarium yas marina (33 seconds ago.)catche consoleloge consoletrace (34 seconds ago.)