Yahoo.com.bd  |  Yahoo Everything - All sites in different languages and countries
Low trust score  | 
Find a sitemap of all Yahoo Sites




Yahoo.com.bd Website Information

Website Ranks & Scores for Yahoo.com.bd

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:6%
DMOZ DMOZ Listing:No

Who hosts Yahoo.com.bd?

Yahoo.com.bd is hosted by Yahoo! in California, Sunnyvale, United States, 94089.
Yahoo.com.bd has an IP Address of 74.6.50.150 and a hostname of w2.src.vip.bf1.yahoo.com.



Yahoo.com.bd Web Server Information

Hosted IP Address:74.6.50.150
Hosted Hostname:w2.src.vip.bf1.yahoo.com
Service Provider:Yahoo!
Hosted Country:United StatesUS
Location Latitude:37.4249
Location Longitude:-122.0074
Webserver Software:Not Applicable

HTTP Header Analysis for Yahoo.com.bd

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 08 Dec 2015 00:44:51 GMT
P3P: policyref="http://info.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
X-Yahoo-Request-Id: 8db26lpb6ca03
X-Frame-Options: SAMEORIGIN
Content-Type: text/html;charset=utf-8
X-Cache: MISS from ncache3.global.media.ir2.yahoo.com
X-Cache-Lookup: MISS from ncache3.global.media.ir2.yahoo.com:4080
Via: 1.1 ncache13.global.media.ir2.yahoo.com-2:3128 (squid/2.7.STABLE9), 1.1 ncache3.global.media.ir2.yahoo.com:4080 (squid/2.7.STABLE9), http/1.1 yts263.global.media.ir2.yahoo.com (ApacheTrafficServer [cMsSfW]), http/1.1 r01.ycpi.loa.yahoo.net (ApacheTrafficServer [cMsSf ])
X-Media-Gzip: true
Server: ATS
Cache-Control: max-age=0, private
Expires: -1
Strict-Transport-Security: max-age=172800
Content-Encoding: gzip
Age: 106
Transfer-Encoding: chunked
Connection: keep-alive
Y-Trace: BAEAQAAAAABbYsVzojMcpgAAAAAAAAAA8fpu6MOnKesAAAAAAAAAAAAFJlhOZFNDAAUmWE5k3V0ThAyjAAAAAA--


Need to find out who hosts Yahoo.com.bd?

Yahoo.com.bd Free SEO Report

Website Inpage Analysis for Yahoo.com.bd

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yahoo.com.bd

maw1230pxwindowpushadperfmetricmoreexperienceits notwindowperformancegetentriesbynamenavigatestartpx10pxdistractingi dontdont youhelping us improveha mih100relevantits distractingi dontcfffmaw1230px miw984px mxadistractingicatchelsethank youposmiw984pxstart0 end0nameimprove your yahoohabdw1pxmodalpostopenop1 posa t76pxyahoo experienceitst76px collapsibleuht60pxwindowperformancepagesee adslearnbgzcvlikerelevantitst76pxadits offensivesomethingonfoffensivesomethingbdtw1px dn hamxa modalopendbwindowperformancemarkyour yahoo2 only screenexperienceitssolidtrsdu013strstfeo trsde0sfz11pxbreakingcurpimprove1bdrs11pxend0 maw1230pxwhsnwundefinedonly screenmodalpostopendb w100 h100if windowperformancedn hacollapsibleuht60px start0modalpostopendb w100newsdont you likemaw1230px miw984pxh100climprove yourconsoleerrorethrowmiw984px mxatrstfeo trsde0s trsdu013sdont likeoffensivesomething elsethank youseetacbrowserfz11px fwb posamodalopendbellwindowsfhostmodalpostopenop1 posaend0trsde0s trsdu013ssee adslearn moredont2ifelsethankmstart14pxnotus improve yournewwidthccfujipurple1c fz14px fwbdeferretry2 onlyadsenddonewhymih100 modalpostopenop1 posaadslearnyournot relevantitslh17catch e consoleerrorethrowmih100 modalpostopenop1t76px collapsibleuht60px start0mailboxesiddo i seeposrendadsenddonewhy doadits offensivesomething elsethankmodalopendb modalpostopendbatl1slugfontfamilyhelveticae consoleerrorethrowlike this adsenddonewhystartp0trynot relevantits distractingimodalopendb modalpostopendb w100windowdarlaeventstrstfeo0offensivesomething elsethankdarlatry ifposa w100aditsfz14px fwbdibfunctionneuehelveticaarialsansseriffontweight300magsfontasize1fontsize13pxmagsfontasize2fontsize16pxmagsfontasize3fontsize20pxmagsfontasize4fontsize22pxmagsfontasize5fontsize33pxmagsfontasize6fontsize35pxmagsfontasize7fontsize58pxmagsfontasize8fontsize70pxmagsfontasize9fontsize100pxmagsfontbfontfamilygeorgiatimesseriffontweight400magsfontbsize1fontsize18pxmagsfontcfontfamilyhelvetica1pxh40pxposidbdtw1pxus improvehelpingdn ha mih100bdtw1px dnfwblh26collapsibleuht60px start0 end0experienceits not relevantitstdnhwindowperformance windowperformancemarkposaelistnyou likeyahoo experienceits notmore about yourelseposa t76pxyahooflstartdne consoleerrorethrow ebdrs11px cfffha mih100 modalpostopenop1ccfujipurple1c fz14pxstart endccfujipurple1cw100usmodalpostopenop1dib ccfujipurple1c fz14pxtdncollapsibleuht60pxfunctioneventnamew100 h100dbmih100msgrelevantits distractingimxa modalopendb modalpostopendbdoyoustart0fz14pxstart0 end0 maw1230pxposa t76px collapsibleuht60pxfwb vathelping usonf bdtw1px dnfz14px fwb vatmodalpostopendbonf bdtw1pxcatch emiw984px mxa modalopendbyour yahoo experienceitsvaryou for helpingvatymreqidymreqidadslearn morefwb posascreenie8pb10pxdib ccfujipurple1ccmdend0 maw1230px miw984pxtrsde0sfz13pxmxamt1pxdistractingi dont likefz11px fwbmegathemeeventnameelse ifconsoleerrorethrow enewonly

Longtail Keyword Density for Yahoo.com.bd

KeywordsOccurences
fz14px fwb vat4
catch e consoleerrorethrow4
posa t76px collapsibleuht60px3
t76px collapsibleuht60px start03
collapsibleuht60px start0 end03
modal-postopenop1 posa t76px3
ha mih100 modal-postopenop13
bdtw1px dn ha3
dn ha mih1003
start0 end0 maw1230px3
mih100 modal-postopenop1 posa3
end0 maw1230px miw984px3
fz11px fwb posa3
dib cc-fuji-purple-1-c fz14px3
cc-fuji-purple-1-c fz14px fwb3
modal-postopendb w100 h1003
modal-opendb modal-postopendb w1003
maw1230px miw984px mxa3
miw984px mxa modal-opendb3
mxa modal-opendb modal-postopendb3
onf bdtw1px dn3
trstfeo trsde0s trsdu013s3
us improve your3
improve your yahoo3
your yahoo experienceits3
helping us improve3
you for helping3
dont you like3
adits offensivesomething elsethank3
offensivesomething elsethank you3
yahoo experienceits not3
experienceits not relevantits3
see adslearn more3
more about your3
e consoleerrorethrow e3
do i see3
like this adsenddonewhy3
not relevantits distractingi3
relevantits distractingi dont3
distractingi dont like3
2 only screen3
catch e8
windowperformance windowperformancemark7
only screen6
if windowperformance6
dont like5
fz14px fwb5
fwb vat4
trstfeo trsde0s4
e consoleerrorethrow4
else if4
dn ha3
t76px collapsibleuht60px3
posa t76px3
collapsibleuht60px start03
modal-postopenop1 posa3
ha mih1003
mih100 modal-postopenop13
start0 end03
mxa modal-opendb3
fz11px fwb3
bdrs11px cfff3
fwb posa3
dib cc-fuji-purple-1-c3
cc-fuji-purple-1-c fz14px3
w100 h1003
modal-postopendb w1003
maw1230px miw984px3
miw984px mxa3
bdtw1px dn3
modal-opendb modal-postopendb3
end0 maw1230px3
consoleerrorethrow e3
offensivesomething elsethank3
elsethank you3
helping us3
us improve3
adits offensivesomething3
you like3
2 only3
start end3
try if3
dont you3
improve your3
your yahoo3
see adslearn3
adslearn more3
trsde0s trsdu013s3
posa w1003
adsenddonewhy do3
distractingi dont3
yahoo experienceits3
experienceits not3
not relevantits3
relevantits distractingi3
onf bdtw1px3
if23
dib16
var15
function15
014
posa14
windowperformance13
e12
your11
db11
vat11
neuehelveticaarialsans-seriffont-weight300mags-fontasize1font-size13pxmags-fontasize2font-size16pxmags-fontasize3font-size20pxmags-fontasize4font-size22pxmags-fontasize5font-size33pxmags-fontasize6font-size35pxmags-fontasize7font-size58pxmags-fontasize8font-size70pxmags-fontasize9font-size100pxmags-fontbfont-familygeorgiatimesseriffont-weight400mags-fontbsize1font-size18pxmags-fontcfont-familyhelvetica9
fwb9
news9
tdn9
catch8
dont8
you8
tac8
not8
like8
else7
start07
windowdarlaevents7
posr7
windowperformancemark7
cfff6
end06
only6
screen6
name6
try6
w1006
eventname5
pos5
new5
cc-fuji-purple-1-c5
mxa5
posid5
fz13px5
ell5
yahoo5
whsnw5
curp5
p05
fz14px5
h40px4
lh174
trsde0s4
tdnh4
solid4
mailboxesid4
1px4
dn4
bdtw1px4
trstfeo4
end4
functioneventname4
msg4
start4
consoleerrorethrow4
darla4
cl4
relevantits3
helping3
elsethank3
offensivesomething3
experienceits3
breaking3
bgzcv3
us3
13
improve3
ymreqidymreqid3
fz11px3
listn3
ie-8pb10px3
mstart14px3
windowperformancegetentriesbynamenavigatestart3
23
mt-1px3
windowpushadperfmetric3
adits3
bdrs11px3
distractingi3
atl1slugfont-familyhelvetica3
flstart3
do3
modal-postopenop13
mih1003
t76px3
collapsibleuht60px3
newwidth3
ha3
cmd3
deferretry3
megatheme3
trsdu013s3
windowsfhost3
onf3
maw1230px3
miw984px3
lh263
adslearn3
see3
bdw1px3
adsenddonewhy3
more3
browser3
modal-opendb3
undefined3
modal-postopendb3
h1003
page3
px10px3

What are the nameservers for yahoo.com.bd?


Yahoo.com.bd Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yahoo.com.bd is a scam?