Yahoo.com.my  |  Yahoo
Low trust score  | 
News, email and search are just the beginning. Discover more every day.

Yahoo.com.my Website Information

Yahoo.com.my has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 2,177,452, a Majestic Rank of 0, a Domain Authority of 34% and is not listed in DMOZ.

Yahoo.com.my is hosted by Yahoo! in California, Sunnyvale, United States, 94089.
Yahoo.com.my has an IP Address of 74.6.50.150 and a hostname of w2.src.vip.bf1.yahoo.com.

The domain yahoo.com.my was registered 201 decades 9 years 2 days ago by , it was last modified 201 decades 9 years 2 days ago and currently is set to expire 201 decades 9 years 2 days ago.


Who hosts Yahoo.com.my?

Yahoo.com.my Web Server Information

Hosted IP Address:74.6.50.150
Hosted Hostname:w2.src.vip.bf1.yahoo.com
Service Provider:Yahoo!
Hosted Country:United StatesUS
Location Latitude:37.4249
Location Longitude:-122.0074
Webserver Software:Not Applicable

HTTP Header Analysis for Yahoo.com.my

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 28 Feb 2016 07:50:52 GMT
P3P: policyref="http://info.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
Strict-Transport-Security: max-age=2592000
X-Frame-Options: DENY
Vary: Accept-Encoding
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Age: 0
Transfer-Encoding: chunked
Connection: keep-alive
Via: http/1.1 ir13.fp.ir2.yahoo.com (ApacheTrafficServer)
Server: ATS
Cache-Control: no-store, no-cache, private, max-age=0
Expires: -1
Y-Trace: BAEAQAAAAABvFAlhGWqiXQAAAAAAAAAA7ntVYRFfPXAAAAAAAAAAAAAFLM_KnpzgAAUsz8qf_z1wMt8ZAAAAAA--


Need to find out who hosts Yahoo.com.my?

Yahoo.com.my Free SEO Report

Website Inpage Analysis for Yahoo.com.my

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yahoo.com.my

labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose adshowadshow adcollapsecollapsefdbifontfamily helvetica neuecschtmlwindowperformance windowperformancenowpslengthmorefontsizeymsgdatae ifwindowismodalopenifurl urlsearchhttpadshowadshowbodytagseeadcodeenmy is3rd 0sarawak999999999999999999999999 err facstatus0 userprovideddatacscurifacstatus hasexternalhasexternalintegerlumpurexpiressetminutesexpiresgetminutesdaysifurl urlsearchhttp 1documentwritedont you likeyeardatemalay mailpositemsize 1x1latesthighbodytag documentgetelementsbytagnamebody0 bodytagclassnameymreqidymreqidaftransportyou likehasexternal 0servetypevisiblematchid 999999999999999999999999theyservetime 1504168466902757returnenmy slotdatamostneue helvetica arialundefinedplacementidmailnumberexpires domain locationhostnamesansseriffontweightview yoursettimeoutfunctiondaydlabeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclosebookidmerdekavar bodytag documentgetelementsbytagnamebody0slotdataymediayouwindowaddeventlistenerload functionuklangnode pathup0 userprovideddata htmlcliprapidconfigfdbintl enmyerrpagepeoplenonexpdont youmalaysiadomainlike sponsoredadfdbintlnowexpiresfirstfacstatusadc labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclosetimeshelvetica arial sansseriffontweightadidgetcanbreakingkuala lumpurkualaerr facstatus hasexternalupdateshelvetica neue helveticaif msgdatabodytag documentgetelementsbytagnamebody0backfalsepagemodesitehladsall eventnamenational dayrequires aftransport pathfdbintl enmy slotdataposnameoneposid1 slotidurlexpires domainviewbehavior nonexpfdbexp 1504175666902nullpolicevaroverwecuradclassnamereplacednmodlangbundlesexpandedusnew tabis3rd 0 userprovideddatatypeservetype 1 slotidfullits19xb0c highlikeymediaone positemconfclean5if ymediasuntwowindowperformancenowadcollapsecollapsefdbi dontfdb fdburlurlsearchhttp 1documentwriteifurltopdislikey cschtml nifwindowxzqdnullwindowxzqdnewfdbexp 1504175666902 fdbintladcodeenmy is3rdwrapmmetapositemconfcleandont likesnowfdburlif windowaddeventlistenermyelsecontentconversation sign0 sizedomain locationhostnamerainif windowaddeventlistener windowaddeventlistenerloadmail onlinefdbon 110var ltime windowperformancenowmalay mail onlinefontfamily helveticarequires node1504168466902757 behavior nonexpadcollapsecollapsefdbi dont like4gbjpositemhaserr positemsizenifwindowxzqdnullwindowxzqdnew19xb0cchiefvideo clip999999999999999999999999 errrequiresouteventname hladsall eventnamedocumentgetelementsbytagnamebody0 bodytagclassname1documentwrite idnonexp adidwindowperformancerequires node pathrequires aftransportbehavior nonexp adidgalaxyarialallexpires expirescuradclassname999999999999999999999999fdbexpheartssuppugc 0datrkpositionhladsalladindexdocumentgetelementsbytagnamebody0idyourhaselse if msgdatanew dategettimemasttypeof1504168466902757 behaviorexpires expires domainlocalesif windowperformance windowperformancenowfindfunctionyouth chief0 placementiddategettimewindowperformancenow varhelvetica neuerazif1documentwriteepositemlowwindowperformance windowperformancenow var11newsnews8he8matchid 999999999999999999999999 errenmyaftransport pathfdbcreativeidkeepnewsmeta y cschtmleventname hladsallservetype 1number integeradcodeenmyrsuppugclike this adcodeenmyiffalse else ifstartnewsnew straitscschtml nifwindowxzqdnullwindowxzqdnewelse ifpathymediaone positemconfclean wrapwindowaddeventlistener windowaddeventlistenerload6skipwindowremoveeventlistenerloadmayuserprovideddata htmlterengganumsgnamemeta ysaidneue helveticaselectif windowperformanceurl ifurlmalaytodayy cschtmlslotidvar bodytagnodelike newsnewpossizeadshowadshow adcollapsecollapsefdbi dontpositemhaserrsizepositemhaserr positemsize 1x1helvetica arialnolabeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose adshowadshowgamesponsoredimpidexpires newnamevar ltimestatefalse elseconversationymediaonehavelocationhostnamearial sansseriffontweightbodytagclassnameloaddefaultbundlesuppugc 0 placementidmathroundltimebrowseradcurlsearchhttp 1documentwrite id4fontfamilyonline1 fdbexp 1504175666902windowaddeventlistener912storiesltime windowperformancenow0latertruefdbondefault3hladsall eventname hladscustomumnoservetimeyoullcurad1 fdbexpnew dateyahoo as youradc labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose adshowadshowhasexternal 0 sizenexttabstraitslike newsnew straitspositemsizecuradclassname curadclassnamereplacedndontis3rdservetime 1504168466902757 behaviordatastraits times1504175666902 fdbintl enmyeventname hladscustomwindowaddeventlistener windowaddeventlistenerload functionstart the conversation1504175666902 fdbintleventnamematchidhereyahoovideois3rd 0facstatus hasexternal 017searchrequires pathmalaysianhomeif eventname hladsallfree1x1newifmsgnamelthousandsrunurl ifurl urlsearchhttpwindowaddeventlistenerload2aberr facstatusnewsnew straits timesmillionpositemconfclean wrapbehaviornotwindowperformancenow var ltimeyouthneueadcollapsecollapsefdbiadshowadshow adcollapsecollapsefdbiltimeif eventnameazizuserprovideddatabreaking newshelveticaurlsearchhttpjustismonfetchmailboxesidhtmlnationalexpires new datehladscustomsignfdbon 1 fdbexp

Longtail Keyword Density for Yahoo.com.my

KeywordsOccurences
start the conversation10
newsnew straits times9
helvetica neue helvetica6
neue helvetica arial6
font-family helvetica neue6
helvetica arial sans-seriffont-weight6
like newsnew straits6
adc labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose adshowadshow4
labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose adshowadshow adcollapsecollapsefdbi4
1504175666902 fdbintl en-my4
adshowadshow adcollapsecollapsefdbi dont4
fdbexp 1504175666902 fdbintl4
fdbintl en-my slotdata4
var bodytag documentgetelementsbytagnamebody04
bodytag documentgetelementsbytagnamebody0 bodytagclassname4
else if msgdata4
1 fdbexp 15041756669024
is3rd 0 userprovideddata4
adcodeen-my is3rd 04
adcollapsecollapsefdbi dont like4
like this adcodeen-my4
y cschtml nifwindowxzqdnullwindowxzqdnew4
servetime 1504168466902757 behavior4
url ifurl urlsearchhttp4
ifurl urlsearchhttp -1documentwrite4
fdbon 1 fdbexp4
urlsearchhttp -1documentwrite id4
suppugc 0 placementid4
meta y cschtml4
hasexternal 0 size4
servetype -1 slotid4
facstatus hasexternal 04
err facstatus hasexternal4
matchid 999999999999999999999999 err4
999999999999999999999999 err facstatus4
windowaddeventlistener windowaddeventlistenerload function3
if windowaddeventlistener windowaddeventlistenerload3
requires node path3
malay mail online3
expires domain locationhostname3
expires expires domain3
expires new date3
yahoo as your3
requires af-transport path3
if windowperformance windowperformancenow3
dont you like3
if eventname hladsall3
0 userprovideddata html3
1504168466902757 behavior nonexp3
behavior nonexp adid3
eventname hladsall eventname3
hladsall eventname hladscustom3
windowperformance windowperformancenow var3
windowperformancenow var ltime3
ymediaone positemconfclean -wrap3
false else if3
positemhaserr positemsize 1x13
var ltime windowperformancenow3
requires path24
conversation sign10
straits times10
newsnew straits9
number integer9
else if7
font-family helvetica6
helvetica neue6
arial sans-seriffont-weight6
helvetica arial6
neue helvetica6
dont like6
like newsnew6
if windowperformance5
if msgdata5
if ymedia5
meta y5
1504175666902 fdbintl4
adcodeen-my is3rd4
fdbexp 15041756669024
is3rd 04
adcollapsecollapsefdbi dont4
adshowadshow adcollapsecollapsefdbi4
fdbintl en-my4
0 userprovideddata4
labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose adshowadshow4
en-my slotdata4
like sponsored4
ltime windowperformancenow4
var bodytag4
bodytag documentgetelementsbytagnamebody04
documentgetelementsbytagnamebody0 bodytagclassname4
19xb0c high4
breaking news4
1 fdbexp4
kuala lumpur4
national day4
windowperformance windowperformancenow4
adc labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose4
cschtml nifwindowxzqdnullwindowxzqdnew4
suppugc 04
0 placementid4
fdbon 14
y cschtml4
-1documentwrite id4
url ifurl4
ifurl urlsearchhttp4
urlsearchhttp -1documentwrite4
1504168466902757 behavior4
servetime 15041684669027574
hasexternal 04
facstatus hasexternal4
servetype -14
-1 slotid4
fdb fdburl4
err facstatus4
0 size4
999999999999999999999999 err4
matchid 9999999999999999999999994
expires expires3
youth chief3
new dategettime3
expires domain3
windowaddeventlistenerload function3
domain locationhostname3
requires node3
expires new3
requires af-transport3
new tab3
video clip3
view your3
new date3
af-transport path3
windowaddeventlistener windowaddeventlistenerload3
node path3
you like3
dont you3
e if3
if eventname3
eventname hladsall3
userprovideddata html3
nonexp adid3
malay mail3
mail online3
behavior nonexp3
hladsall eventname3
eventname hladscustom3
positemconfclean -wrap3
windowperformancenow var3
var ltime3
ymediaone positemconfclean3
curadclassname curadclassnamereplaced-n3
positemhaserr positemsize3
positemsize 1x13
false else3
if windowaddeventlistener3
if73
requires60
path60
058
var53
your34
font-size34
127
like21
false21
new21
function19
you19
true14
sign13
helvetica12
start12
data11
else11
up11
conversation10
news10
windowperformancenow10
dont10
straits10
yahoo10
y10
times10
number9
newsnew9
expires9
not9
size9
integer9
more9
ymedia8
curadclassname8
positem8
lang8
j8
ad7
posname7
en-my7
position7
content7
us7
27
video7
no7
mail7
37
out6
msgdata6
windowperformance6
e6
curad6
url6
eventname6
chief6
get6
back6
return6
neue6
arial6
breaking6
said6
font-family6
latest6
sans-seriffont-weight6
today6
see6
1x16
bodytagclassname6
kuala5
m5
positemconfclean5
id5
keep5
stories5
home5
page5
locales5
next5
day5
nifwindowxzqdnullwindowxzqdnew5
here5
meta5
ab5
ltime5
44
fdbintl4
adc4
is3rd4
adcodeen-my4
adcollapsecollapsefdbi4
adshowadshow4
labeladchoicesurlhttpsinfoyahoocomprivacyusyahoorelevantadshtmlcloseclosecloseadclose4
userprovideddata4
slotdata4
54
mast4
64
bodytag4
mailboxesid4
modlangbundlesexpanded4
loaddefaultbundle4
name4
select4
74
datrk4
date4
updates4
documentgetelementsbytagnamebody04
ifmsgname4
-wrap4
positemhaserr4
l4
mathroundltime4
windowismodalopen4
84
undefined4
default4
94
fdbexp4
sarawak4
he4
have4
fdbon4
its4
104
19xb0c4
html4
ifurl4
online4
low4
high4
has4
million4
people4
uk4
sponsored4
first4
view4
dislike4
run4
114
national4
merdeka4
lumpur4
urlsearchhttp4
police4
placementid4
slotid4
servetype4
bookid4
fdburl4
behavior4
9999999999999999999999994
fdb4
creativeid4
servetime4
124
suppugc4
hasexternal4
-1documentwrite4
adid4
matchid4
facstatus4
err4
cschtml4
cscuri4
impid4
browser3
ymreqidymreqid3
top3
may3
search3
they3
youll3
thousands3
tab3
later3
game3
type3
my3
rain3
snow3
dategettime3
rapidconfig3
null3
locationhostname3
domain3
expiressetminutesexpiresgetminutes3
skip3
find3
can3
most3
sun3
two3
just3
we3
s83
galaxy3
4gb3
days3
over3
state3
d3
posid3
youth3
adindex3
possize3
hearts3
malaysian3
year3
aziz3
ymediaone3
hladsall3
ismonfetch3
pslength3
hladscustom3
malay3
curadclassnamereplaced-n3
full3
positemsize3
settimeoutfunction3
now3
node3
nonexp3
free3
clip3
af-transport3
pagemode3
r3
malaysia3
site3
windowremoveeventlistenerload3
windowaddeventlistenerload3
razif3
msgname3
terengganu3
umno3
visible3
windowaddeventlistener3
one3
typeof3
all3

What are the nameservers for yahoo.com.my?

Yahoo.com.my Domain Nameserver Information

HostIP AddressCountry
ns1.yahoo.com 68.180.131.16United States United States
ns5.yahoo.com 119.160.247.124Taiwan Taiwan
ns3.yahoo.com 203.84.221.53Hong Kong SAR China Hong Kong SAR China
ns2.yahoo.com 68.142.255.16United States United States
ns6.yahoo.com 121.101.144.139India India
ns4.yahoo.com 98.138.11.157United States United States

Yahoo.com.my Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yahoo.com.my is a scam?