Yahoo.com.tw  |  Yahoo奇摩
Low trust score  | 
最新Yahoo奇摩首頁, 提供最方便的網站搜尋、即時新聞、生活資訊和Yahoo奇摩服務入口




Yahoo.com.tw Website Information

Website Ranks & Scores for Yahoo.com.tw

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:75,256
Majestic Rank Majestic Rank:43,826
Domain Authority Domain Authority:80%
DMOZ DMOZ Listing:No

Whois information for yahoo.com.tw

Full Whois Lookup for Yahoo.com.tw Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Yahoo.com.tw. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: yahoo.com.tw
Domain Status: clientTransferProhibited,clientDeleteProhibited,clientUpdateProhibited
Registrant:
Yahoo! Inc.
Domain Administrator Login to show email
First Avenue
Sunnyvale, CA
US

Administrative Contact:
Domain Administrator Login to show email
Contact:
Domain Administrator Login to show email
expires on 2019-07-12 (YYYY-MM-DD)
Record created on 1997-05-01 (YYYY-MM-DD)

Domain servers in listed order:
ns1.yahoo.com
ns2.yahoo.com
ns3.yahoo.com
ns4.yahoo.com
ns5.yahoo.com

Registration Service Provider: Markmonitor, Inc.

[Provided by NeuStar Registry Gateway Services]

Who hosts Yahoo.com.tw?

Yahoo.com.tw is hosted by Yahoo! in California, Sunnyvale, United States, 94089.
Yahoo.com.tw has an IP Address of 74.6.50.150 and a hostname of w2.src.vip.bf1.yahoo.com and runs ATS web server.



Yahoo.com.tw Web Server Information

Hosted IP Address:74.6.50.150
Hosted Hostname:w2.src.vip.bf1.yahoo.com
Service Provider:Yahoo!
Hosted Country:United StatesUS
Location Latitude:37.4249
Location Longitude:-122.0074
Webserver Software:ATS

HTTP Header Analysis for Yahoo.com.tw

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 22 May 2015 17:18:42 GMT
P3P: policyref="http://info.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
Strict-Transport-Security: max-age=2592000
X-Frame-Options: DENY
Vary: Accept-Encoding
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Age: 2
Transfer-Encoding: chunked
Connection: keep-alive
Via: http/1.1 ir13.fp.ir2.yahoo.com (ApacheTrafficServer)
Server: ATS
Cache-Control: no-store, no-cache, private, max-age=0
Expires: -1


Need to find out who hosts Yahoo.com.tw?

Yahoo.com.tw Free SEO Report

Website Inpage Analysis for Yahoo.com.tw

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yahoo.com.tw

transparenttabadstabpanelecmcenterseparatortab atabadstabpanelecmcenterseparatortabgradienttype0 ecmsmall overlaywordsbottom12pxfontsize16pxbillboarduhspancolor000importantbordertop3px solid transparentborderbottom0tabadstabpanelecmcenterppu activeadtravel imgborder0utiltraveladsaftransport path10pxritem labelwidth38862559241ecmhalf listmarginbottom4pxmarginbottomcalc10137714285892pxecmdefault item1 fdbexprequires pathtopleft bottomcolorstop1rgba0000colorstop20rgba0000colorstop100rgba0009backgroundwebkitlineargradienttoprgba0000 1rgba0000ramen rater12gbtextlinkhovertextdecorationunderlineutiltravelads adtravel imgborder0utiltraveladsjigaenode path278pxecmhalf item labelwidth38862559241ecmhalfsolid d6d6d6positionabsoluteleft0padding8px 0paddingbottom0paddingbottom0tabadstabpanelecmcenterseparatortabblocknone streamengmoreoverlaywordsecmsmall overlaywordsfontsize13pxmedialih1 spanabutabssimpletabsseparatortab lih2eclist overlaywordspadding0documentgetelementsbytagnamebody0display noneneue helvetica arialsansserifpphwcleanbtnbackgroundposition258pxselectedright abutabssimpletabsseparatortabecbestbuypromoicontop7pxleft10pxpadding0selected spancolor000importantbordercolor400090tabadstabpanelecmcenterseparatortabdocumentgetelementsbytagnamebody0 bodytagclassnameneedyuiusenodebasepaldo budae jigaeyui3widgetftadlieneschlaptopmicrosoft jhengheiuserinfo4g uk datavodafone1rgba0000 20rgba0009 100backgroundlineargradienttoscreen and maxwidth1185pxecmsmall5pxminwidth15pxheight14pxbackgroundcoloref4e5eecbestbuytabcountdown tabheadericonbackgroundposition0 164pxecbestbuytablistfontsize12pxmarginbottom5pxecmsmall bannerecmsmalltopleft bottomcolorstop1rgba0000colorstop20rgba0000colorstop100rgba0009backgroundwebkitlineargradienttoprgba0000aftransportabutabssimpletabsseparatortab selected spanbackgroundcolorfafaffrightpromoadlineheight33pxcolor00fimportantright8pxtabadstabpanelecmcenterseparatortabtextlinkhovertextdecorationunderlineutiltravelads adtravel8pxliborderright1px solid transparentborderleft1pxcurrynodeitemmargintop10pxmarginbottom4pxmargintopcalc1 278pxmarginbottomcalc1 278pxecmhalftransparentborderbottom0tabadstabpanelecmcenter selected atabadstabpanelecmcenterdisplay block28pxseparatorabutabssimpletabsseparatortaboverlaywordsecmsmall overlaywordsfontsize12pxecececseparatortabitemmargintop10pxmarginbottom4pxmargintopcalc1 278pxmarginbottomcalc1needunderlinehovertextdecorationunderlineimportantecmdefaultpaddingbottom312796209ecmdefault itemmarginbottom4pxmarginbottomcalc285714286 137714285892pxecmdefaulttabheadericontop7pxtop10pxleft4pxseparatortab ecbestbuytab278pxecmhalfecbestbuytabmarginleft0paddingleft0separatortab8pxbottom12pxeclist rightulpaddingleft31eclist needunderlinecolorfffimportanteclistulwidth67media maxwidth1040pxutiltravelads ulwidth64utiltraveladslabelwidth38862559241ecmhalf listmarginbottom4pxmarginbottomcalc10rgba000065 0rgba0000arial stheitilabelwidth38862559241ecmdefaultnullvisibleoverlaybannercolorffffontsize16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000 1rgba0000 20rgba0009ulwidth64utiltravelads myadskt7positionabsolutetop15pxright0utiltravelads darlamarginleft16pxutiltravelads14px8pphwundobtnbackgroundposition258pxscreen and maxwidth1043pxecmhalfrgba0000 0rgba0000651rgba0000 20rgba0009 100backgroundolineargradienttoprgba00004wrapheight134pxutilbrandadsymediaendcolorstre6000000 gradienttype0 eclistj278pxmarginbottomcalc1zindexecbestbuytabcountdown tabheaderpromodisplaynoneecbestbuytab tabheadericonbackgroundrepeatnorepeatbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepngbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuytabecbestbuypromoicontop7pxleft10pxpadding0 5pxminwidth15pxheight14pxbackgroundcoloref4e5eecbestbuytabcountdownlogowidth100pxheight65pxmarginbottom3pxutillifeads ulmarginright8pxutillifeads wrapheight134pxutilbrandadslitab1selectedabutabssimpletabsseparatortab0rgba0000 1008px 0 8pxbottom12pxeclisttextlinkcolor324fe1whitespacenowrapoverflowhiddentextoverflowellipsisdisplayblockutiltravelads adtravel textlinkhovertextdecorationunderlineutiltraveladsspanabutabssimpletabsseparatortab lih2 spanabutabssimpletabsseparatortab138pxecmsmall item labelwidth38862559241ecmsmallstream socialsharingcontainervauxhallramenlabelwidth38862559241ecmdefault listmarginbottom4pxmarginbottomcalc68181818abutabssimpletabsseparatortab litab1selectedborderleftcolord6d6d6tabadstabpanelecmcenter10aabutabssimpletabsseparatortab selected spancolor7300ffimportantbordercolord6d6d6bordertopcolor7300ffbackgroundcolorfffrighttabheaderpromodisplaynoneecbestbuytab tabheadericonbackgroundrepeatnorepeatbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepngbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuytabliwidth16tabadstabpanelecmcenterseparatortab promoadlineheight33pxcolor00fimportantright8pxtabadstabpanelecmcenterseparatortabatabadstabpanelecmcenter selected spancolor000importantbordercolor400090tabadstabpanelecmcenterseparatortabpathulwidth67media maxwidth1040pxutiltraveladsspanbackgroundcolorfafaffright abutabssimpletabsseparatortab selectedlastnavlistselectedright abutabssimpletabsseparatortab selectedjsstreamcontenttextlinkcolor324fe1whitespacenowrapoverflowhiddentextoverflowellipsisdisplayblockutiltravelads adtravelitemmarginbottom4pxmarginbottomcalc43 138pxecmsmallurl ifurl urlsearchhttpselected separatortabadstabpanelecmcenterseparatortab selectedlifind outecbestbuytabcountdown tabheaderpromodisplaynoneecbestbuytabwebackgroundpaddingright20gbliselectedabutabssimpletabsseparatortabvar ltimetab1 separatorabutabssimpletabsseparatortab selectedtabheadericonpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackgroundposition0maxwidth1040pxutiltravelads ulwidth64utiltraveladsadtravel imgborder0utiltravelads adtravelwrapwidth104pxoverflowxhiddenutiltraveladsliwidth16tabadstabpanelecmcenterseparatortabbottomcolorstop1rgba0000colorstop20rgba0000colorstop100rgba0009backgroundwebkitlineargradienttoprgba0000 1rgba0000linemyadskt7positionabsolutetop15pxright0utiltravelads darlamarginleft16pxutiltraveladsgradienttype0spancolor000importantbordercolor400090tabadstabpanelecmcenterseparatortab selected atabadstabpanelecmcenterseparatortablistfontsize12pxmarginbottom5pxecmsmallpositemppgf9pxsolid transparentborderbottom0tabadstabpanelecmcenter selectedatextdecorationnonefontsize13pxutiltravelads adtravel ahovertextdecorationunderlineutiltraveladsstenciloverlaywordsbottom12pxfontsize16pxbillboard ecmsmalloverlaywordsbottom12pxfontsize16pxbillboardspancolor7300ffimportantbordercolord6d6d6bordertopcolor7300ffbackgroundcolorfffrightmykualitheno20rgba0009 100backgroundolineargradienttoprgba0000 1rgba00001stheiti100backgroundolineargradienttoprgba0000 1rgba0000spanabutabssimpletabsseparatortab aabutabssimpletabsseparatortablitab1selectedborderleftcolortransparentright abutabssimpletabsseparatortab litab1selectedborderleftcolord6d6d6tabadstabpanelecmcenteroverlaywordsfontsize14pxmedialocalesfindselected atabadstabpanelecmcenterseparatortab selectedimgborder0utiltravelads adtravelwrapwidth104pxoverflowxhiddenutiltravelads adtraveloverlaywordsfontsize15pxmedia screensolid fafaffpaddingbottom1pxheight36px9height36pxright abutabssimpletabsseparatortabbanneroverlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000 1rgba0000d6d6d6positionabsoluteleft0padding8px 0paddingbottom0paddingbottom0tabadstabpanelecmcenterseparatortabf1f1f1stencilliabutabssimpletabsseparatortab liborderright1pxtabheadericonbackgroundrepeatnorepeatbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepngbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuytab tabheadericonpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackgroundposition0 187pxecbestbuytab4gwgetseparatorabutabssimpletabsseparatortab separatorborderleft1px solidli0rgba0000gridspreadmarginbottom0utiltraveladsrequires node pathabutabssimpletabsseparatortab selectedlasthidden4gbgradienttype0 eclistbannerecmsmall14separatorabutabssimpletabsseparatortab tab1brandadscontainermarginright10pxutilbrandads100backgroundmslineargradienttoprgba0000 1rgba00006pxsettimeoutfunction4g ukw window100backgroundolineargradienttoprgba0000 1rgba0000 20rgba0009separatortabadstabpanelecmcenterseparatortab tab1 separatorabutabssimpletabsseparatortabitem labelwidth38862559241ecmsmalladtl2bexpiresoverlaywordsecmsmall overlaywordsfontsize13pxmedia screenyuiusenodebase functionylistfontsize12pxmarginbottom5pxecmhalfpaddingbottom156398105ecmhalf itemmargintop10pxmarginbottom4pxmargintopcalc1 278pxmarginbottomcalc1ecbestbuytab tabheadericonseparatortaberrorliwidth23abutabssimpletabsseparatortab linr2width26abutabssimpletabsseparatortabif windowperformancelogowidth100pxheight65pxmarginbottom3pxutillifeads ulmarginright8pxutillifeadsfunctionyltimefunction varlistmarginbottom4pxmarginbottomcalc10 167pxmedia screenmaxwidth1043pxecmdefault listfontsize12pxmarginbottom5pxecmhalfpaddingbottom156398105ecmhalf itemmargintop10pxmarginbottom4pxmargintopcalc1maxwidth1043pxecmsmall listfontsize12pxmarginbottom5pxmediasetncommeta yliselectedborderbottom1px solid fafaffpaddingbottom1pxheight36px9height36pxrightcontenttextfontsize12pxecminnercontainerisecuserpaddingbottom312796209ecminnercontainerpaddingbottom156eclistscreen and maxwidth1019pxbillboardvar urlatabadstabpanelecmcenter spancolor5f5f5fimportantborderbottom4px solidseparatorabutabssimpletabsseparatortab selected separatorabutabssimpletabsseparatortabcarjen nyonyamyadskt7positionabsolutetop15pxright0utiltravelads darlamarginleft16pxutiltravelads gridspreadmarginbottom0utiltraveladsjigae ramyunbottomrgba0000 1rgba0000 20rgba0009positionadtravel atextdecorationnonefontsize13pxutiltravelads adtravelsolid transparentborderleft1pxahovertextdecorationunderlineutiltravelads adtravel agencycolor1e7d83width52pxmarginright8pxfloatleftutiltraveladsselected arighttrywindowperformancetabheadericonseparatortab ecbestbuytabcountdownpromotebannermargintop10pxwidth315minheight187pxminwidth187pxeclistselected separatorabutabssimpletabsseparatortab9bottomcolorstop1rgba0000colorstop20rgba0000colorstop100rgba0009backgroundwebkitlineargradienttoprgba0000164pxecbestbuytab tabheaderpromocolorfc6767fontstylenormalfontsize13pxfontsize13rempaddingleft3pxdisplaynoneecbestbuytabcountdowntextlinkhovertextdecorationunderlineutiltraveladswindowperformancenow var ltimeneedunderlinecolorfffimportanteclistliselectedbordercolord6d6d6borderbottom1px solidsavearialyouecmsmall overlaywordsfontsize14pxecmsmalldefaultmaxwidth1019pxbillboard ecmsmallvodafone uk sponsoredyahoomaxwidth1019pxbillboard ecmsmall overlaywordsecmsmallspancolor5f5f5fimportantborderbottom4pxspanfontsize15pxtabadstabpanelecmcenterseparatortabecmsmallbannerecmsmall banneroverlaywidth945widthcalc9375187pxecbestbuytab ecbestbuypromoicontop7pxleft10pxpadding0adtravelwrapwidth104pxoverflowxhiddenutiltravelads adtravelbodytag documentgetelementsbytagnamebody0litab1selectedabutabssimpletabsseparatortab litab1selectedborderleftcolortransparentrightarightmaxwidth1185pxecmsmall overlaywordsfontsize15pxmedia screenspanfontsize15pxtabadstabpanelecmcenterseparatortab liselectedabutabssimpletabsseparatortabseparatortabadstabpanelecmcenterseparatortabmykualilih3 spanfontsize15pxtabadstabpanelecmcenterseparatortab liselectedabutabssimpletabsseparatortabeclistlabelwidth38862559241ecmhalf listmarginbottom4pxmarginbottomcalc10 167pxmedianeedunderlinehovertextdecorationunderlineimportantecmdefaultpaddingbottom312796209ecmdefault itemmarginbottom4pxmarginbottomcalc285714286itemmarginbottom4pxmarginbottomcalc43rightulpaddingleft31eclist needunderlinecolorfffimportanteclist100backgroundmslineargradienttoprgba0000ifurl urlsearchhttp 1documentwriteoverlaywordspadding0 8px 0tabheaderpromodisplayinlineutiltravelads ulwidth67media40pxbanneroverlaywidth945widthcalc9375 39375pxecmsmall banneroverlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba00001pxfdbexpliselectedbordercolord6d6d6borderbottom1pxliabutabssimpletabsseparatortab liborderright1px solidoverlaywordsfontsize13pxmediaselected atabadstabpanelecmcenter selectedulmarginright8pxutillifeads wrapheight134pxutilbrandadsgridspreadmarginbottom0utiltravelads adtravelatextdecorationnonefontsize13pxutiltraveladss8bottomcolorstop1rgba0000colorstop20rgba0000colorstop100rgba0009backgroundwebkitlineargradienttoprgba0000 1rgba0000 20rgba00092separatorborderleftcolortransparentecbestbuytabmarginleft12paddingleft36pxborderleft1pxliborderright1pxcontenttextfontsize12pxecminnercontainerisecuserpaddingbottom312796209ecminnercontainerpaddingbottom156eclist promotebannermargintop10pxwidth315minheight187pxminwidth187pxeclist promotepaddingblockwidth314minwidth187pxheight100pxeclistecmsmall overlaywordsecmsmall overlaywordsfontsize12pxulmarginright8pxutillifeadslistmarginbottom4pxmarginbottomcalc68181818 10386363606pxmedia screenspanfontsize15pxtabadstabpanelecmcenterseparatortab liselectedabutabssimpletabsseparatortab liselectedbordercolord6d6d6borderbottom1pxtabheaderpromocolorfc6767fontstylenormalfontsize13pxfontsize13rempaddingleft3pxdisplaynoneecbestbuytabcountdownstheiti microsoftsolid transparenttabadstabpanelecmcenterseparatortab atabadstabpanelecmcenterseparatortabselected spancolor7300ffimportantbordercolord6d6d6bordertopcolor7300ffbackgroundcolorfffright abutabssimpletabsseparatortabneedunderlinehovertextdecorationunderlineimportantecmdefaultpaddingbottom312796209ecmdefaultyui3aclistaabutabssimpletabsseparatortabkitchenabutabssimpletabsseparatortab litab1selectedborderleftcolord6d6d6tabadstabpanelecmcenter atabadstabpanelecmcentergalaxy20rgba0009 100backgroundmslineargradienttoprgba0000spanborderrightcolortransparenttabadstabpanelecmcenterseparatortab separatorabutabssimpletabsseparatortab separatorborderleft1px13transparentborderbottom0tabadstabpanelecmcenterspancolor5f5f5fimportantborderbottom4px solid transparenttabadstabpanelecmcenterseparatortababutabssimpletabsseparatortab liselectedlastchildborderrightcolortransparenttabadstabpanelecmcenterseparatortab litab1selectedabutabssimpletabsseparatortabsolid transparenttabadstabpanelecmcenterseparatortab liwidth16tabadstabpanelecmcenterseparatortabtabheadericonseparatortab138pxecmsmall itemspanborderrightcolortransparenttabadstabpanelecmcenterseparatortabfunction10386363606pxmedia screenrequires aftransportsamsung galaxy s8100filterprogiddximagetransformmicrosoftgradient startcolorstr00000000selectedli separatorabutabssimpletabsseparatortab tab18pxbottom12pxeclist rightulpaddingleft31eclist20rgba0009 100backgroundwebkitgradientlinearleftliselectedabutabssimpletabsseparatortab liselectedbordercolord6d6d6borderbottom1px278pxmarginbottomcalc1 278pxecmhalfabufzmfontsize16pxfontsize16remsmallsize abufzmfontsize14pxfontsize14remseparatortabbackgroundcolorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabadstabpanelecmcenterseparatortab liabutabssimpletabsseparatortabitem labelwidth38862559241ecmsmall listmarginbottom4pxmarginbottomcalc68181818moztransformlih1 spanabutabssimpletabsseparatortab12vvcarousel liuk sponsoredfffmarginbottom1pxfontweight700right abutabssimpletabsseparatortablitab1selectedborderleftcolortransparentright abutabssimpletabsseparatortabendcolorstre6000000 gradienttype0gridspreadmarginbottom0utiltravelads adtravel atextdecorationnonefontsize13pxutiltraveladsfffmarginbottom1pxfontweight700right abutabssimpletabsseparatortab liselectedborderbottom1px20rgba0009 100filterprogiddximagetransformmicrosoftgradientdata0rgba000065abutabssimpletabsseparatortabdimaxwidth1040pxutiltraveladssolid transparenttabadstabpanelecmcenterseparatortabatabadstabpanelecmcenter spancolor5f5f5fimportantborderbottom4px0rgba0000 20rgba00090 0maxwidth1043pxecmhalfecbestbuytab tabheadericontop7pxtop10pxleft4pxseparatortabagencycolor1e7d83width52pxmarginright8pxfloatleftutiltravelads adtravel textlinkcolor324fe1whitespacenowrapoverflowhiddentextoverflowellipsisdisplayblockutiltravelads167pxmediavideoplayingvideoplaylistweatherapptitleweatherdownloadappyahooappweatherlatestupdateweathermoreinformationweathertodayweathertomorrowhpsetmakehpsetyourhomepagesponsoredsuggestionsuggestionshortautoplaydefaultonofftventrytvtransportxhrtdapicontextbucket235devicedesktoplangzhhanttwregiontwsitefpmaxwidth1043pxecmhalf listfontsize12pxmarginbottom5pxecmsmall bannerecmsmallselectedrightspancolor000importantbordercolor400090tabadstabpanelecmcenterseparatortab selectedadtravel100backgroundwebkitgradientlinearleft0rgba000065 100 backgroundstraitsitem labelwidth38862559241ecmdefault listmarginbottom4pxmarginbottomcalc681818183pxmargintophansabutodayselected spanabutabssimpletabsseparatortab11pxtabheaderpromodisplayinlineutiltravelads ulwidth67media maxwidth1040pxutiltraveladsspanbackgroundcolorfafaffrightseparatorabutabssimpletabsseparatortab selectedli separatorabutabssimpletabsseparatortabfdbintldayshelvetica arial stheiti5pxminwidth15pxheight14pxbackgroundcoloref4e5eecbestbuytabcountdownsamsung galaxylitab1selectedborderleftcolord6d6d6tabadstabpanelecmcenter atabadstabpanelecmcenter spancolor5f5f5fimportantborderbottom4pxbudae jigaetransformundefinedoverlaywordsfontsize12px1rgba0000 20rgba0009ifaright abutabssimpletabsseparatortabrequires aftransport pathrequires nodestartcolorstr000000000pphwpanel ppualwaysmetawindowperformance windowperformancenowstartcolorstr00000000 endcolorstre6000000 gradienttype00pxbodytag documentgetelementsbytagnamebody0 bodytagclassnametabheadericonbackgroundrepeatnorepeatbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepngbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuytabvar url ifurlpromotepaddingblockwidth314minwidth187pxheight100pxeclist overlaybannercolorffffontsize16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000 1rgba0000liborderright1px solidabutabssimpletabsseparatortab liselectedborderbottom1px solidcarjen nyonya curry12pxppu hoveroverlaywordsbottom12pxfontsize16pxbillboard ecmsmall overlaywordsfontsize14pxecmsmall29pxintlselectormstransformvar bodytagtopleftunlimited43pxintlselector160paddingbottom0paddingbottom0tabadstabpanelecmcenterseparatortab3s easefffmarginbottom1pxfontweight700rightsolid ecececseparatortab20gb datatabheadericonbackgroundrepeatnorepeatbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepngbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuytab tabheadericonpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackgroundposition0liselectedbordercolord6d6d6borderbottom1px solid fffmarginbottom1pxfontweight700righturlsearchhttp 1documentwrite varscreen and maxwidth1072pxbillboardzhhanttwmaxwidth1043pxecmdefault listfontsize12pxmarginbottom5pxecmhalfpaddingbottom156398105ecmhalfabufzmfontsize14pxfontsize14remseparatortabbackgroundcolorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabadstabpanelecmcenterseparatortababufzmfontsize16pxfontsize16remsmallsizeselected aabutabssimpletabsseparatortab selectedurlsearchhttp 1documentwrite abufzmfontsize16pxfontsize16remsmallsizeifmsgnamemaxwidth1019pxbillboardaabutabssimpletabsseparatortab selectedneedunderlinehovertextdecorationunderlineimportantecmsmall itemmarginbottom4pxmarginbottomcalc43 138pxecmsmallliselectedabutabssimpletabsseparatortab liselectedbordercolord6d6d6borderbottom1px solidfalseborderradiuslitab1selectedborderleftcolortransparentrightselected spancolor000importantbordercolor400090tabadstabpanelecmcenterseparatortab selectedposidbackgroundcolor4pxecmsmall overlaywordsfontsize14pxecmsmall needunderlinecolorfffimportantecmsmallfontsizetransparentborderleft1px solid transparenttabadstabpanelecmcenterseparatortabuk databanneroverlaywidth945widthcalc9375neueprice of 4gbboileronesolid fafaffpaddingbottom1pxheight36px9height36pxrightlistfontsize12pxmarginbottom5pxmediaseparatortabadstabpanelecmcenterseparatortab tab1promoadhovertextdecorationunderlineabutabssimpletabsseparatortab liwidth23abutabssimpletabsseparatortab linr2width26abutabssimpletabsseparatortab11windowliwidth23abutabssimpletabsseparatortab linr2width26abutabssimpletabsseparatortab lih1linr2width26abutabssimpletabsseparatortab lih1spanabutabssimpletabsseparatortab lih2rightulpaddingleft31eclistlabelwidth38862559241ecmsmall listmarginbottom4pxmarginbottomcalc68181818 10386363606pxmediadarlamarginleft16pxutiltravelads8pxbottom12pxeclistsponsored xe080liwidth23abutabssimpletabsseparatortabtab1 separatorborderleftcolortransparentecbestbuytabmarginleft12paddingleft36pxborderleft1pxhelveticalistmarginbottom4pxmarginbottomcalc10 167pxmediaitemmarginbottom4pxmarginbottomcalc43 138pxecmsmall itemspanabutabssimpletabsseparatortab aabutabssimpletabsseparatortab spancolor000importantbordertop3pxatabadstabpanelecmcenterseparatortab spanabutabssimpletabsseparatortab aabutabssimpletabsseparatortabspanabutabssimpletabsseparatortab lih3tabheadericonbackgroundposition0 164pxecbestbuytablitab1selectedabutabssimpletabsseparatortab litab1selectedborderleftcolortransparentright abutabssimpletabsseparatortab167pxmedia screenbanneroverlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000spanabutabssimpletabsseparatortab lih3 spanfontsize15pxtabadstabpanelecmcenterseparatortab278pxmarginbottomcalc1 278pxecmhalf itemmicrosoft jhenghei sansseriflistmarginbottom4pxmarginbottomcalc68181818ifurl urlsearchhttpabufzmfontsize16pxfontsize16remsmallsize abufzmfontsize14pxfontsize14remseparatortabbackgroundcolorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabadstabpanelecmcenterseparatortabmathroundltime0 9px 00 8pxbottom12pxeclist rightulpaddingleft31eclistulmarginright8pxutillifeads wrapheight134pxutilbrandads brandadscontainermarginright10pxutilbrandadsgradienttype0 ecmsmalladtravel logowidth100pxheight65pxmarginbottom3pxutillifeads ulmarginright8pxutillifeads1documentwrite abufzmfontsize16pxfontsize16remsmallsize abufzmfontsize14pxfontsize14remseparatortabbackgroundcolorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabadstabpanelecmcenterseparatortab1rgba0000 20rgba0009 100backgroundmslineargradienttoprgba0000abutabssimpletabsseparatortab selectedrightlistmarginbottom4pxmarginbottomcalc10ppudategettimecarjenfafaffpaddingbottom1pxheight36px9height36pxrightfallbacktargetnode39375pxecmsmall banneroverlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000promotebannermargintop10pxwidth315minheight187pxminwidth187pxeclist promotepaddingblockwidth314minwidth187pxheight100pxeclist overlaybannercolorffffontsize16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000uh yui3aclistselectedlastjhengheiseparatorborderleft1pxneedunderlinehovertextdecorationunderlineimportantecmsmall itemmarginbottom4pxmarginbottomcalc43needunderlinecolorfffimportantecmsmall needunderlinehovertextdecorationunderlineimportantecmsmall1pxintlselectormaxwidth1128pxecmsmall overlaywordsfontsize14pxmedia screen100backgroundlineargradientto bottomrgba0000curadclassnamejsstreamfeaturedadselectedlast arightlangselected separatortabadstabpanelecmcenterseparatortabtranslatey97pxadtravel ahovertextdecorationunderlineutiltravelads adtraveloverlaywordspadding0ecbestbuytabmarginleft0paddingleft0separatortab ecbestbuytab tabheadericontop7pxtop10pxleft4pxseparatortab20rgba0009 100backgroundwebkitgradientlinearleft topleftwebkittransformadtravel ahovertextdecorationunderlineutiltraveladspagemode100backgroundmslineargradienttoprgba0000 1rgba0000 20rgba0009stream jsstreamfeaturedadstheiti microsoft jhengheilabelwidth38862559241ecmhalfmaxwidth1072pxbillboardstartcolorstr00000000 endcolorstre6000000autooverlaywordspadding0 8pxbottomrgba0000 1rgba0000overlaywordsfontsize14pxmedia screenurl ifurltransparentborderleft1px solidoverlaywordsfontsize14pxecmsmallnonearight abutabssimpletabsseparatortab selectedspanbackgroundcolorfafaffright abutabssimpletabsseparatortabcanadaahovertextdecorationunderlineutiltraveladsabutabssimpletabsseparatortab liselectedlastchildborderrightcolortransparenttabadstabpanelecmcenterseparatortabrightitem labelwidth38862559241ecmhalfwindowismodalopen2px187pxecbestbuytabatabadstabpanelecmcenter selectedlih3 spanfontsize15pxtabadstabpanelecmcenterseparatortab0164pxecbestbuytab tabheaderpromocolorfc6767fontstylenormalfontsize13pxfontsize13rempaddingleft3pxdisplaynoneecbestbuytabcountdown tabheaderpromodisplayinlineutiltravelads1documentwrite varecbestbuytabadtravel agencycolor1e7d83width52pxmarginright8pxfloatleftutiltravelads adtravelimg20rgba0009 100backgroundolineargradienttoprgba0000heightundefined varitem labelwidth38862559241ecmdefaultposdata0paddingbottom0paddingbottom0tabadstabpanelecmcenterseparatortab selected separatortabadstabpanelecmcenterseparatortabpossize100backgroundwebkitgradientlinearleft topleftrgba0000 0rgba000065 100needunderlinecolorfffimportanteclist needunderlinehovertextdecorationunderlineimportantecmdefaultpaddingbottom312796209ecmdefaultaabutabssimpletabsseparatortab spancolor000importantbordertop3pxd6d6d6positionabsoluteleft0padding8pxdarlamarginleft16pxutiltravelads gridspreadmarginbottom0utiltravelads adtravelatabadstabpanelecmcenterseparatortab spanabutabssimpletabsseparatortablih2 spanabutabssimpletabsseparatortab lih3fallbackhtmlcontentbrandadscontainermarginright10pxutilbrandads contenttextfontsize12pxecminnercontainerisecuserpaddingbottom312796209ecminnercontainerpaddingbottom156eclist137714285892pxecmdefault137714285892pxecmdefault item labelwidth38862559241ecmdefaultselectedli separatortabadstabpanelecmcenterseparatortab tab1displayneue helveticalistfontsize12pxmarginbottom5pxecmhalfpaddingbottom156398105ecmhalfscreenheight 3s ease15pxintlselectorutilweathersolid fffmarginbottom1pxfontweight700right abutabssimpletabsseparatortab0paddingbottom0paddingbottom0tabadstabpanelecmcenterseparatortab selectedspanborderrightcolortransparenttabadstabpanelecmcenterseparatortab separatorabutabssimpletabsseparatortababutabssimpletabsseparatortab liselectedborderbottom1pxsize100backgroundlineargradienttoeaseselected aright abutabssimpletabsseparatortabliselectedborderbottom1px solidpaldovvcarouselsolid fffmarginbottom1pxfontweight700rightlabelwidth38862559241ecmsmall listmarginbottom4pxmarginbottomcalc68181818100backgroundwebkitgradientlinearleft topleft bottomcolorstop1rgba0000colorstop20rgba0000colorstop100rgba0009backgroundwebkitlineargradienttoprgba0000endcolorstre6000000 gradienttype0 ecmsmall15helvetica arialulwidth67mediaheight 3sjhenghei sansserifmaxwidth1185pxecmsmallspanabutabssimpletabsseparatortab selected aabutabssimpletabsseparatortabsingaporeselected spanbackgroundcolorfafaffright abutabssimpletabsseparatortaboverlaywordsfontsize15pxmediaukseparatorborderleftcolortransparentecbestbuytabmarginleft12paddingleft36pxborderleft1px solid ecececseparatortabltime windowperformancenowmicrosoftabutabssimpletabsseparatortab selectedlast spanborderrightcolortransparenttabadstabpanelecmcenterseparatortab1rgba0000tabstabheadericontop7pxtop10pxleft4pxseparatortab ecbestbuytab tabheadericonseparatortaburlsearchhttp 1documentwritespancolor000importantbordercolor400090tabadstabpanelecmcenterseparatortab20rgba0009 100backgroundlineargradientto bottomrgba0000nyonya curryno upfront5px streamneedunderlinecolorfffimportantecmsmall needunderlinehovertextdecorationunderlineimportantecmsmall itemmarginbottom4pxmarginbottomcalc43importantmaxwidth1043pxecmhalf listfontsize12pxmarginbottom5pxecmsmallcitronliselectedlastchildborderrightcolortransparenttabadstabpanelecmcenterseparatortab litab1selectedabutabssimpletabsseparatortab litab1selectedborderleftcolortransparentrightsplashtopstickyecmsmall overlaywordsecmsmall overlaywordsfontsize13pxmediaspancolor000importantbordertop3px soliddatrktvadtravel atextdecorationnonefontsize13pxutiltravelads0pphwpanelselectedli separatortabadstabpanelecmcenterseparatortabecmsmall overlaywordsbottom12pxfontsize16pxbillboardtransparentborderleft1pxscreen and maxwidth1043pxecmdefaultseparatorborderleft1px solidfdbonname1documentwrite abufzmfontsize16pxfontsize16remsmallsizeseparatorabutabssimpletabsseparatortab tab1 separatorborderleftcolortransparentecbestbuytabmarginleft12paddingleft36pxborderleft1pxvaritemmarginbottom4pxmarginbottomcalc285714286adtravelwrapwidth104pxoverflowxhiddenutiltravelads adtravel logowidth100pxheight65pxmarginbottom3pxutillifeadslitab1selectedborderleftcolord6d6d6tabadstabpanelecmcenter atabadstabpanelecmcenterouttabheadericonpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackgroundposition0 187pxecbestbuytabseparatortabadstabpanelecmcenterseparatortab selectedli separatortabadstabpanelecmcenterseparatortabgalaxy s8urlsearchhttpabufzmfontsize14pxfontsize14remseparatortabbackgroundcolorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabadstabpanelecmcenterseparatortab liabutabssimpletabsseparatortab liborderright1pxwindowperformance windowperformancenow varspancolor5f5f5fimportantborderbottom4px solidramyuninitialpageloadstream vvcarouselecbestbuytabcountdownmaxwidth1043pxecmsmall listfontsize12pxmarginbottom5pxmedia screenbestfafaffpaddingbottom1pxheight36px9height36pxright abutabssimpletabsseparatortabmaxwidth1128pxecmsmallwidth100backgroundolineargradienttoprgba0000selected spanabutabssimpletabsseparatortab selectedmoneyyrgba000065 0rgba0000 100darlamarginleft16pxutiltravelads gridspreadmarginbottom0utiltraveladsmaxwidth1043pxecmsmallpaddingadtravel textlinkhovertextdecorationunderlineutiltravelads adtraveladindexlineheightmaxwidth1043pxecmdefaultlabelwidth38862559241ecmdefault listmarginbottom4pxmarginbottomcalc68181818 10386363606pxmediaborderbottom39375pxecmsmall banneroverlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000 1rgba0000xe080separatorabutabssimpletabsseparatortab selectedliitem0rgba2552552550164pxecbestbuytab1rgba0000 20rgba0009 100filterprogiddximagetransformmicrosoftgradient75stypeof100 backgroundcontenttextfontsize12pxecminnercontainerisecuserpaddingbottom312796209ecminnercontainerpaddingbottom156eclist promotebannermargintop10pxwidth315minheight187pxminwidth187pxeclist100filterprogiddximagetransformmicrosoftgradient startcolorstr00000000 endcolorstre6000000overlaybannercolorffffontsize16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000idoverlaybannercolorffffontsize16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000 1rgba0000rightulpaddingleft31eclist needunderlinecolorfffimportanteclist needunderlinehovertextdecorationunderlineimportantecmdefaultpaddingbottom312796209ecmdefaultmykualithe ramenarial stheiti microsoftopacityloaddefaultbundlecolorseparatortabadstabpanelecmcenterseparatortab selectedlirgba0000tabheaderpromodisplaynoneecbestbuytab tabheadericonbackgroundrepeatnorepeatbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepngbackgroundimageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuytab tabheadericonpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackgroundposition0new dategettimevar bodytag documentgetelementsbytagnamebody00 9pxatabadstabpanelecmcenterseparatortab selectedspancolor7300ffimportantbordercolord6d6d6bordertopcolor7300ffbackgroundcolorfffright abutabssimpletabsseparatortab selectedright5pxminwidth15pxheight14pxbackgroundcoloref4e5eecbestbuytabcountdown tabheadericonbackgroundposition0agencycolor1e7d83width52pxmarginright8pxfloatleftutiltraveladsnyonyaselectedlast aright abutabssimpletabsseparatortabmaxwidth1072pxbillboard ecmsmallecbestbuytab tabheadericonseparatortab ecbestbuytabcountdownmaxwidth1185pxecmsmall overlaywordsfontsize15pxmediaselectedli separatorabutabssimpletabsseparatortabsolidpromotebannermargintop10pxwidth315minheight187pxminwidth187pxeclist promotepaddingblockwidth314minwidth187pxheight100pxeclistadtravel agencycolor1e7d83width52pxmarginright8pxfloatleftutiltravelads0rgba0000 100 background20rgba0009tabheadericonbackgroundposition020rgba0009 100backgroundlineargradienttotabheadericonpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackgroundposition0 187pxecbestbuytab ecbestbuypromoicontop7pxleft10pxpadding0187pxecbestbuytab ecbestbuypromoicontop7pxleft10pxpadding0 5pxminwidth15pxheight14pxbackgroundcoloref4e5eecbestbuytabcountdowntabheadericonbackgroundposition0 164pxecbestbuytab tabheaderpromocolorfc6767fontstylenormalfontsize13pxfontsize13rempaddingleft3pxdisplaynoneecbestbuytabcountdownecbestbuytab tabheadericontop7pxtop10pxleft4pxseparatortab ecbestbuytabfffselected separatorabutabssimpletabsseparatortab selectedlilistmarginbottom4pxmarginbottomcalc68181818 10386363606pxmediamaxwidth1072pxbillboard ecmsmall overlaywordsecmsmallscreen and maxwidth1128pxecmsmallseparatorborderleft1px solid d6d6d6positionabsoluteleft0padding8pxlih3100backgroundlineargradientto bottomrgba0000 1rgba0000spancolor7300ffimportantbordercolord6d6d6bordertopcolor7300ffbackgroundcolorfffright abutabssimpletabsseparatortabsocialsharingcontainerselected aabutabssimpletabsseparatortablih2back6urlselected atabadstabpanelecmcenterfdbon 1 fdbexpecmsmall overlaywordsbottom12pxfontsize16pxbillboard ecmsmalllistfontsize12pxmarginbottom5pxecmsmall bannerecmsmall banneroverlaywidth945widthcalc9375tabheaderpromodisplaynoneecbestbuytab5pxminsliselectedborderbottom1pxabutabssimpletabsseparatortab selectedright abutabssimpletabsseparatortabstreameoverlaywordsfontsize14pxecmsmall needunderlinecolorfffimportantecmsmall0 8pxbottom12pxeclistscreen and maxwidth1043pxecmsmallimgborder0utiltraveladstransparenttabadstabpanelecmcenterseparatortab liwidth16tabadstabpanelecmcenterseparatortab promoadlineheight33pxcolor00fimportantright8pxtabadstabpanelecmcenterseparatortabulwidth64utiltraveladstab1upfrontecececseparatortab ecbestbuytabmarginleft0paddingleft0separatortab ecbestbuytablookingwindowperformancenow varitemmarginbottom4pxmarginbottomcalc285714286 137714285892pxecmdefault itemelsespanabutabssimpletabsseparatortab selectedulwidth64utiltravelads myadskt7positionabsolutetop15pxright0utiltraveladstranslatez0tabheaderpromocolorfc6767fontstylenormalfontsize13pxfontsize13rempaddingleft3pxdisplaynoneecbestbuytabcountdown tabheaderpromodisplayinlineutiltravelads ulwidth67media1rgba0000 20rgba0009 100backgroundwebkitgradientlinearleftadtravelwrapwidth104pxoverflowxhiddenutiltraveladstextlinkcolor324fe1whitespacenowrapoverflowhiddentextoverflowellipsisdisplayblockutiltravelads04000900rgba000065 100solid transparentborderleft1px solid1documentwrite100filterprogiddximagetransformmicrosoftgradientselected spanbackgroundcolorfafaffrighteyebrowahovertextdecorationunderlineutiltravelads adtravelbodytagwrapheight134pxutilbrandads brandadscontainermarginright10pxutilbrandadsmediawrapheight134pxutilbrandads brandadscontainermarginright10pxutilbrandads contenttextfontsize12pxecminnercontainerisecuserpaddingbottom312796209ecminnercontainerpaddingbottom156eclisttransparenttabadstabpanelecmcenterseparatortab atabadstabpanelecmcenterseparatortab spanabutabssimpletabsseparatortabprice3sifurlselectedlilih2 spanabutabssimpletabsseparatortabitemmargintop10pxmarginbottom4pxmargintopcalc1adtravel logowidth100pxheight65pxmarginbottom3pxutillifeadsbodytagclassnameatabadstabpanelecmcenterseparatortabpromoadlineheight33pxcolor00fimportantright8pxtabadstabpanelecmcenterseparatortab promoadhovertextdecorationunderlineabutabssimpletabsseparatortab liwidth23abutabssimpletabsseparatortabneedunderlinehovertextdecorationunderlineimportantecmsmallecececseparatortab ecbestbuytabmarginleft0paddingleft0separatortabitemmarginbottom4pxmarginbottomcalc285714286 137714285892pxecmdefaultlabelwidth38862559241ecmsmalllistfontsize12pxmarginbottom5pxmedia screen20rgba0009 100backgroundmslineargradienttoprgba0000 1rgba0000active7translatey42pxrapidconfigoverlaywordsecmsmall9px 0listfontsize12pxmarginbottom5pxecmhalfpaddingbottom156398105ecmhalf itemmargintop10pxmarginbottom4pxmargintopcalc1138pxecmsmallpromoadhovertextdecorationunderlineabutabssimpletabsseparatortab liwidth23abutabssimpletabsseparatortabfilterseparatorabutabssimpletabsseparatortab separatorborderleft1pxoverlaywordsfontsize13pxmedia screentabheadericonseparatortab ecbestbuytabcountdown tabheaderpromodisplaynoneecbestbuytabrequirestransparentborderbottom0tabadstabpanelecmcenter selectedimgborder0utiltravelads adtravelwrapwidth104pxoverflowxhiddenutiltraveladsaright abutabssimpletabsseparatortab selectedlasttab1 separatorabutabssimpletabsseparatortabbanneroverlaywidth945widthcalc9375 39375pxecmsmallpromoadhovertextdecorationunderlineabutabssimpletabsseparatortabselected atabadstabpanelecmcenterseparatortabseparatorborderleftcolortransparentecbestbuytabmarginleft12paddingleft36pxborderleft1px solidwindowperformancenowselected spancolor7300ffimportantbordercolord6d6d6bordertopcolor7300ffbackgroundcolorfffrightlogowidth100pxheight65pxmarginbottom3pxutillifeadsspanabutabssimpletabsseparatortababutabssimpletabsseparatortab selectedatextdecorationnonefontsize13pxutiltravelads adtravelvodafone uklih1brandadscontainermarginright10pxutilbrandads contenttextfontsize12pxecminnercontainerisecuserpaddingbottom312796209ecminnercontainerpaddingbottom156eclist promotebannermargintop10pxwidth315minheight187pxminwidth187pxeclisttabheaderpromocolorfc6767fontstylenormalfontsize13pxfontsize13rempaddingleft3pxdisplaynoneecbestbuytabcountdown tabheaderpromodisplayinlineutiltraveladsliselectedlastchildborderrightcolortransparenttabadstabpanelecmcenterseparatortab litab1selectedabutabssimpletabsseparatortabmaxwidth1128pxecmsmall overlaywordsfontsize14pxmedia8px 0if windowperformance windowperformancenowsamsungfdbon 1lefttransparenttabadstabpanelecmcenterseparatortabliabutabssimpletabsseparatortabmyadskt7positionabsolutetop15pxright0utiltraveladslitab1selectedborderleftcolord6d6d6tabadstabpanelecmcenterecbestbuytabmarginleft0paddingleft0separatortab ecbestbuytabstream vvcarousel listoryitemtopatabadstabpanelecmcenterseparatortab selected spanabutabssimpletabsseparatortabtab1 separatorborderleftcolortransparentecbestbuytabmarginleft12paddingleft36pxborderleft1px solidadtravel textlinkcolor324fe1whitespacenowrapoverflowhiddentextoverflowellipsisdisplayblockutiltraveladssolid d6d6d6positionabsoluteleft0padding8px278pxecmhalf itemselecteduk sponsored xe080ecbestbuypromoicontop7pxleft10pxpadding0 5pxminwidth15pxheight14pxbackgroundcoloref4e5eecbestbuytabcountdown tabheadericonbackgroundposition0budaes8 with 20gbcuradpromoadlineheight33pxcolor00fimportantright8pxtabadstabpanelecmcenterseparatortab promoadhovertextdecorationunderlineabutabssimpletabsseparatortabneedunderlinecolorfffimportantecmsmallselectedlast spanborderrightcolortransparenttabadstabpanelecmcenterseparatortab separatorabutabssimpletabsseparatortabatabadstabpanelecmcenterneedunderlinecolorfffimportanteclist needunderlinehovertextdecorationunderlineimportantecmdefaultpaddingbottom312796209ecmdefault itemmarginbottom4pxmarginbottomcalc285714286abutabssimpletabsseparatortab selectedlast aright10386363606pxmediatabheaderpromodisplayinlineutiltraveladsmailboxesidliselectedlastchildborderrightcolortransparenttabadstabpanelecmcenterseparatortabselectedlast spanborderrightcolortransparenttabadstabpanelecmcenterseparatortabdeclist overlaywordspadding0 8pxbudae jigae ramyunecmsmall overlaywordsecmsmallliwidth16tabadstabpanelecmcenterseparatortab promoadlineheight33pxcolor00fimportantright8pxtabadstabpanelecmcenterseparatortab promoadhovertextdecorationunderlineabutabssimpletabsseparatortab3abutabssimpletabsseparatortab selected arightvar w windowmodlangbundlesexpanded39375pxecmsmall20rgba0009 100filterprogiddximagetransformmicrosoftgradient startcolorstr00000000adtravel textlinkhovertextdecorationunderlineutiltraveladspromotepaddingblockwidth314minwidth187pxheight100pxeclistagencycolor1e7d83width52pxmarginright8pxfloatleftutiltravelads adtraveltransparenttabadstabpanelecmcenterseparatortab liwidth16tabadstabpanelecmcenterseparatortabtruestream splashtopstickysolid transparentborderbottom0tabadstabpanelecmcenter5overfafaffpaddingbottom1pxheight36px9height36pxright abutabssimpletabsseparatortab liselectedlastchildborderrightcolortransparenttabadstabpanelecmcenterseparatortabbottomrgba0000tabheadericontop7pxtop10pxleft4pxseparatortabraterendcolorstre6000000gradienttype0 eclist overlaywordspadding0linr2width26abutabssimpletabsseparatortabbannerecmsmall banneroverlaywidth945widthcalc9375 39375pxecmsmallrgba000065sponsoredlinr2width26abutabssimpletabsseparatortab lih1 spanabutabssimpletabsseparatortabvar ltime windowperformancenowoverlaywordsfontsize14pxecmsmall needunderlinecolorfffimportantecmsmall needunderlinehovertextdecorationunderlineimportantecmsmall1 varabufzmfontsize14pxfontsize14remseparatortabbackgroundcolorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabadstabpanelecmcenterseparatortab liabutabssimpletabsseparatortabseparatorabutabssimpletabsseparatortab selectedmaxwidth1040pxutiltravelads ulwidth64utiltravelads myadskt7positionabsolutetop15pxright0utiltraveladspaldo budaepromotepaddingblockwidth314minwidth187pxheight100pxeclist overlaybannercolorffffontsize16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000d6d6d6positionabsoluteleft0padding8px 0paddingbottom0paddingbottom0tabadstabpanelecmcenterseparatortab selectednewbanneroverlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4backgroundmozlineargradienttoprgba0000 1rgba0000 20rgba0009returnvar wadtravel textlinkcolor324fe1whitespacenowrapoverflowhiddentextoverflowellipsisdisplayblockutiltravelads adtravelsomethingaabutabssimpletabsseparatortab spancolor000importantbordertop3px solidsolid ecececseparatortab ecbestbuytabmarginleft0paddingleft0separatortabspancolor000importantbordertop3pxmmykualithe ramen raterhover

Longtail Keyword Density for Yahoo.com.tw

KeywordsOccurences
url ifurl urlsearchhttp16
ifurl urlsearchhttp -1documentwrite16
20rgba0009 100filterprogiddximagetransformmicrosoftgradient startcolorstr0000000013
100filterprogiddximagetransformmicrosoftgradient startcolorstr00000000 endcolorstre600000013
startcolorstr00000000 endcolorstre6000000 gradienttype013
20rgba0009 100background-webkit-gradientlinearleft topleft13
listmargin-bottom4pxmargin-bottomcalc68181818 10386363606pxmedia screen13
20rgba0009 100backgroundlinear-gradientto bottomrgba000013
100background-webkit-gradientlinearleft topleft bottomcolor-stop1rgba0000color-stop20rgba0000color-stop100rgba0009background-webkit-linear-gradienttoprgba000012
1rgba0000 20rgba0009 100background-webkit-gradientlinearleft12
topleft bottomcolor-stop1rgba0000color-stop20rgba0000color-stop100rgba0009background-webkit-linear-gradienttoprgba0000 1rgba000012
bottomcolor-stop1rgba0000color-stop20rgba0000color-stop100rgba0009background-webkit-linear-gradienttoprgba0000 1rgba0000 20rgba000912
1rgba0000 20rgba0009 100background-o-linear-gradienttoprgba000012
1rgba0000 20rgba0009 100filterprogiddximagetransformmicrosoftgradient12
100background-o-linear-gradienttoprgba0000 1rgba0000 20rgba000912
1rgba0000 20rgba0009 100background-ms-linear-gradienttoprgba000012
20rgba0009 100background-o-linear-gradienttoprgba0000 1rgba000012
100background-ms-linear-gradienttoprgba0000 1rgba0000 20rgba000912
1rgba0000 20rgba0009 100backgroundlinear-gradientto12
100backgroundlinear-gradientto bottomrgba0000 1rgba000012
bottomrgba0000 1rgba0000 20rgba000912
20rgba0009 100background-ms-linear-gradienttoprgba0000 1rgba000012
itemmargin-bottom4pxmargin-bottomcalc285714286 137714285892pxecm-default item7
screen and max-width1043pxecm-default7
item labelwidth38862559241ecm-default listmargin-bottom4pxmargin-bottomcalc681818187
137714285892pxecm-default item labelwidth38862559241ecm-default7
labelwidth38862559241ecm-default listmargin-bottom4pxmargin-bottomcalc68181818 10386363606pxmedia7
brandads-containermargin-right-10pxutil-brandads content-textfont-size12pxecm-inner-containerisecuserpadding-bottom312796209ecm-inner-containerpadding-bottom156ec-list promote-bannermargin-top-10pxwidth315min-height187pxmin-width187pxec-list6
wrapheight134pxutil-brandads brandads-containermargin-right-10pxutil-brandads content-textfont-size12pxecm-inner-containerisecuserpadding-bottom312796209ecm-inner-containerpadding-bottom156ec-list6
content-textfont-size12pxecm-inner-containerisecuserpadding-bottom312796209ecm-inner-containerpadding-bottom156ec-list promote-bannermargin-top-10pxwidth315min-height187pxmin-width187pxec-list promote-padding-blockwidth314min-width187pxheight100pxec-list6
overlay-bannercolorffffont-size16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba0000 1rgba0000 20rgba00096
ulmargin-right-8pxutil-lifeads wrapheight134pxutil-brandads brandads-containermargin-right-10pxutil-brandads6
promote-padding-blockwidth314min-width187pxheight100pxec-list overlay-bannercolorffffont-size16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba0000 1rgba00006
promote-bannermargin-top-10pxwidth315min-height187pxmin-width187pxec-list promote-padding-blockwidth314min-width187pxheight100pxec-list overlay-bannercolorffffont-size16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba00006
ad-travel imgborder0util-travelads ad-travelwrapwidth104pxoverflow-xhiddenutil-travelads6
max-width1040pxutil-travelads ulwidth64util-travelads my-adskt7positionabsolutetop-15pxright0util-travelads6
ulwidth67media max-width1040pxutil-travelads ulwidth64util-travelads6
my-adskt7positionabsolutetop-15pxright0util-travelads darlamargin-left-16pxutil-travelads gridspreadmargin-bottom0util-travelads6
darlamargin-left-16pxutil-travelads gridspreadmargin-bottom0util-travelads ad-travel6
gridspreadmargin-bottom0util-travelads ad-travel atext-decorationnonefont-size13pxutil-travelads6
tab-header-promodisplayinlineutil-travelads ulwidth67media max-width1040pxutil-travelads6
tab-header-promocolorfc6767font-stylenormalfont-size13pxfont-size13rempadding-left3pxdisplaynoneecbestbuy-tabcount-down tab-header-promodisplayinlineutil-travelads ulwidth67media6
ecbestbuy-promo-icontop-7pxleft10pxpadding0 5pxmin-width15pxheight14pxbackground-coloref4e5eecbestbuy-tabcount-down tab-header-iconbackground-position06
-187pxecbestbuy-tab ecbestbuy-promo-icontop-7pxleft10pxpadding0 5pxmin-width15pxheight14pxbackground-coloref4e5eecbestbuy-tabcount-down6
5pxmin-width15pxheight14pxbackground-coloref4e5eecbestbuy-tabcount-down tab-header-iconbackground-position0 -164pxecbestbuy-tab6
tab-header-iconbackground-position0 -164pxecbestbuy-tab tab-header-promocolorfc6767font-stylenormalfont-size13pxfont-size13rempadding-left3pxdisplaynoneecbestbuy-tabcount-down6
-164pxecbestbuy-tab tab-header-promocolorfc6767font-stylenormalfont-size13pxfont-size13rempadding-left3pxdisplaynoneecbestbuy-tabcount-down tab-header-promodisplayinlineutil-travelads6
ad-travel atext-decorationnonefont-size13pxutil-travelads ad-travel6
atext-decorationnonefont-size13pxutil-travelads ad-travel ahovertext-decorationunderlineutil-travelads6
endcolorstre6000000 gradienttype0 ec-list6
textlinkhovertext-decorationunderlineutil-travelads ad-travel imgborder0util-travelads6
imgborder0util-travelads ad-travelwrapwidth104pxoverflow-xhiddenutil-travelads ad-travel6
ad-travelwrapwidth104pxoverflow-xhiddenutil-travelads ad-travel logowidth100pxheight65pxmargin-bottom3pxutil-lifeads6
ad-travel logowidth100pxheight65pxmargin-bottom3pxutil-lifeads ulmargin-right-8pxutil-lifeads6
ad-travel textlinkhovertext-decorationunderlineutil-travelads ad-travel6
textlinkcolor324fe1white-spacenowrapoverflowhiddentext-overflowellipsisdisplayblockutil-travelads ad-travel textlinkhovertext-decorationunderlineutil-travelads6
ahovertext-decorationunderlineutil-travelads ad-travel agencycolor1e7d83width52pxmargin-right8pxfloatleftutil-travelads6
ad-travel ahovertext-decorationunderlineutil-travelads ad-travel6
ad-travel agencycolor1e7d83width52pxmargin-right8pxfloatleftutil-travelads ad-travel6
agencycolor1e7d83width52pxmargin-right8pxfloatleftutil-travelads ad-travel textlinkcolor324fe1white-spacenowrapoverflowhiddentext-overflowellipsisdisplayblockutil-travelads6
ad-travel textlinkcolor324fe1white-spacenowrapoverflowhiddentext-overflowellipsisdisplayblockutil-travelads ad-travel6
logowidth100pxheight65pxmargin-bottom3pxutil-lifeads ulmargin-right-8pxutil-lifeads wrapheight134pxutil-brandads6
need-underlinecolorfffimportantec-list need-underlinehovertext-decorationunderlineimportantecm-defaultpadding-bottom312796209ecm-default itemmargin-bottom4pxmargin-bottomcalc2857142866
138pxecm-small item labelwidth38862559241ecm-small6
itemmargin-bottom4pxmargin-bottomcalc43 138pxecm-small item6
item labelwidth38862559241ecm-small listmargin-bottom4pxmargin-bottomcalc681818186
labelwidth38862559241ecm-small listmargin-bottom4pxmargin-bottomcalc68181818 10386363606pxmedia6
screen and max-width1185pxecm-small6
need-underlinehovertext-decorationunderlineimportantecm-small itemmargin-bottom4pxmargin-bottomcalc43 138pxecm-small6
need-underlinecolorfffimportantecm-small need-underlinehovertext-decorationunderlineimportantecm-small itemmargin-bottom4pxmargin-bottomcalc436
ecm-small overlay-wordsbottom12pxfont-size16pxbillboard ecm-small6
overlay-wordsbottom12pxfont-size16pxbillboard ecm-small overlay-wordsfont-size14pxecm-small6
ecm-small overlay-wordsfont-size14pxecm-small need-underlinecolorfffimportantecm-small6
overlay-wordsfont-size14pxecm-small need-underlinecolorfffimportantecm-small need-underlinehovertext-decorationunderlineimportantecm-small6
max-width1185pxecm-small overlay-wordsfont-size15pxmedia screen6
screen and max-width1128pxecm-small6
max-width1043pxecm-small listfont-size12pxmargin-bottom5pxmedia screen6
screen and max-width1019pxbillboard6
max-width1019pxbillboard ecm-small overlay-wordsecm-small6
ecm-small overlay-wordsecm-small overlay-wordsfont-size12px6
screen and max-width1043pxecm-small6
overlay-wordsecm-small overlay-wordsfont-size13pxmedia screen6
max-width1128pxecm-small overlay-wordsfont-size14pxmedia screen6
screen and max-width1072pxbillboard6
max-width1072pxbillboard ecm-small overlay-wordsecm-small6
ecm-small overlay-wordsecm-small overlay-wordsfont-size13pxmedia6
gradienttype0 ecm-small overlay-wordsbottom12pxfont-size16pxbillboard6
endcolorstre6000000 gradienttype0 ecm-small6
need-underlinehovertext-decorationunderlineimportantecm-defaultpadding-bottom312796209ecm-default itemmargin-bottom4pxmargin-bottomcalc285714286 137714285892pxecm-default6
tab-header-iconpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackground-position0 -187pxecbestbuy-tab ecbestbuy-promo-icontop-7pxleft10pxpadding06
max-width1043pxecm-default listfont-size12pxmargin-bottom5pxecm-halfpadding-bottom156398105ecm-half itemmargin-top10pxmargin-bottom4pxmargin-topcalc16
listfont-size12pxmargin-bottom5pxecm-halfpadding-bottom156398105ecm-half itemmargin-top10pxmargin-bottom4pxmargin-topcalc1 278pxmargin-bottomcalc16
itemmargin-top10pxmargin-bottom4pxmargin-topcalc1 278pxmargin-bottomcalc1 278pxecm-half6
right-ulpadding-left31ec-list need-underlinecolorfffimportantec-list need-underlinehovertext-decorationunderlineimportantecm-defaultpadding-bottom312796209ecm-default6
8pxbottom12pxec-list right-ulpadding-left31ec-list need-underlinecolorfffimportantec-list6
ec-list overlay-wordspadding0 8px6
overlay-wordspadding0 8px 06
8px 0 8pxbottom12pxec-list6
0 8pxbottom12pxec-list right-ulpadding-left31ec-list6
278pxmargin-bottomcalc1 278pxecm-half item6
278pxecm-half item labelwidth38862559241ecm-half6
bannerecm-small banner-overlaywidth945widthcalc9375 39375pxecm-small6
banner-overlaywidth945widthcalc9375 39375pxecm-small banner-overlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba00006
39375pxecm-small banner-overlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba0000 1rgba00006
banner-overlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba0000 1rgba0000 20rgba00096
listfont-size12pxmargin-bottom5pxecm-small bannerecm-small banner-overlaywidth945widthcalc93756
max-width1043pxecm-half listfont-size12pxmargin-bottom5pxecm-small bannerecm-small6
item labelwidth38862559241ecm-half listmargin-bottom4pxmargin-bottomcalc106
labelwidth38862559241ecm-half listmargin-bottom4pxmargin-bottomcalc10 167pxmedia6
listmargin-bottom4pxmargin-bottomcalc10 167pxmedia screen6
screen and max-width1043pxecm-half6
gradienttype0 ec-list overlay-wordspadding06
ulwidth64util-travelads my-adskt7positionabsolutetop-15pxright0util-travelads darlamargin-left-16pxutil-travelads6
litab-1selectedborder-left-colortransparentright abu-tabssimpletabsseparator-tab litab-1selectedborder-left-colord6d6d6tabads-tabpanel-ecmcenter6
litab-1selectedabu-tabssimpletabsseparator-tab litab-1selectedborder-left-colortransparentright abu-tabssimpletabsseparator-tab6
tab-header-iconbackground-repeatno-repeatbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepngbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuy-tab tab-header-iconpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackground-position0 -187pxecbestbuy-tab6
litab-1selectedborder-left-colord6d6d6tabads-tabpanel-ecmcenter atabads-tabpanel-ecmcenter spancolor5f5f5fimportantborder-bottom4px6
atabads-tabpanel-ecmcenter spancolor5f5f5fimportantborder-bottom4px solid6
liselectedlast-childborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab litab-1selectedabu-tabssimpletabsseparator-tab litab-1selectedborder-left-colortransparentright6
abu-tabssimpletabsseparator-tab liselectedlast-childborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab litab-1selectedabu-tabssimpletabsseparator-tab6
abu-tabssimpletabsseparator-tab liselectedborder-bottom1px solid6
liselectedborder-bottom1px solid fafaffpadding-bottom1pxheight36px9height36pxright6
solid fafaffpadding-bottom1pxheight36px9height36pxright abu-tabssimpletabsseparator-tab6
fafaffpadding-bottom1pxheight36px9height36pxright abu-tabssimpletabsseparator-tab liselectedlast-childborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab6
spancolor5f5f5fimportantborder-bottom4px solid transparenttabads-tabpanel-ecmcenterseparator-tab6
solid transparenttabads-tabpanel-ecmcenterseparator-tab atabads-tabpanel-ecmcenterseparator-tab6
transparentborder-bottom0tabads-tabpanel-ecmcenter selected atabads-tabpanel-ecmcenter6
selected atabads-tabpanel-ecmcenter selected6
atabads-tabpanel-ecmcenter selected spancolor000importantborder-color400090tabads-tabpanel-ecmcenterseparator-tab6
selected spancolor000importantborder-color400090tabads-tabpanel-ecmcenterseparator-tab selected6
solid transparentborder-bottom0tabads-tabpanel-ecmcenter selected6
spancolor000importantborder-top3px solid transparentborder-bottom0tabads-tabpanel-ecmcenter6
transparenttabads-tabpanel-ecmcenterseparator-tab atabads-tabpanel-ecmcenterseparator-tab spanabu-tabssimpletabsseparator-tab6
atabads-tabpanel-ecmcenterseparator-tab spanabu-tabssimpletabsseparator-tab aabu-tabssimpletabsseparator-tab6
spanabu-tabssimpletabsseparator-tab aabu-tabssimpletabsseparator-tab spancolor000importantborder-top3px6
aabu-tabssimpletabsseparator-tab spancolor000importantborder-top3px solid6
fffmargin-bottom-1pxfont-weight700right abu-tabssimpletabsseparator-tab liselectedborder-bottom1px6
solid fffmargin-bottom-1pxfont-weight700right abu-tabssimpletabsseparator-tab6
transparentborder-left1px solid transparenttabads-tabpanel-ecmcenterseparator-tab6
solid transparentborder-left1px solid6
solid transparenttabads-tabpanel-ecmcenterseparator-tab liwidth16tabads-tabpanel-ecmcenterseparator-tab6
transparenttabads-tabpanel-ecmcenterseparator-tab liwidth16tabads-tabpanel-ecmcenterseparator-tab promo-adline-height33pxcolor00fimportantright8pxtabads-tabpanel-ecmcenterseparator-tab6
liwidth16tabads-tabpanel-ecmcenterseparator-tab promo-adline-height33pxcolor00fimportantright8pxtabads-tabpanel-ecmcenterseparator-tab promo-adhovertext-decorationunderlineabu-tabssimpletabsseparator-tab6
liborder-right1px solid transparentborder-left1px6
liabu-tabssimpletabsseparator-tab liborder-right1px solid6
urlsearchhttp -1documentwrite abu-fz-mfont-size16pxfont-size16remsmall-size6
-1documentwrite abu-fz-mfont-size16pxfont-size16remsmall-size abu-fz-mfont-size14pxfont-size14remseparator-tabbackground-colorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabads-tabpanel-ecmcenterseparator-tab6
abu-fz-mfont-size16pxfont-size16remsmall-size abu-fz-mfont-size14pxfont-size14remseparator-tabbackground-colorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabads-tabpanel-ecmcenterseparator-tab liabu-tabssimpletabsseparator-tab6
abu-fz-mfont-size14pxfont-size14remseparator-tabbackground-colorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabads-tabpanel-ecmcenterseparator-tab liabu-tabssimpletabsseparator-tab liborder-right1px6
promo-adline-height33pxcolor00fimportantright8pxtabads-tabpanel-ecmcenterseparator-tab promo-adhovertext-decorationunderlineabu-tabssimpletabsseparator-tab liwidth23abu-tabssimpletabsseparator-tab6
promo-adhovertext-decorationunderlineabu-tabssimpletabsseparator-tab liwidth23abu-tabssimpletabsseparator-tab linr2width26abu-tabssimpletabsseparator-tab6
lih3 spanfont-size15pxtabads-tabpanel-ecmcenterseparator-tab liselectedabu-tabssimpletabsseparator-tab6
spanfont-size15pxtabads-tabpanel-ecmcenterseparator-tab liselectedabu-tabssimpletabsseparator-tab liselectedborder-colord6d6d6border-bottom1px6
liselectedabu-tabssimpletabsseparator-tab liselectedborder-colord6d6d6border-bottom1px solid6
liselectedborder-colord6d6d6border-bottom1px solid fffmargin-bottom-1pxfont-weight700right6
spanabu-tabssimpletabsseparator-tab lih3 spanfont-size15pxtabads-tabpanel-ecmcenterseparator-tab6
lih2 spanabu-tabssimpletabsseparator-tab lih36
liwidth23abu-tabssimpletabsseparator-tab linr2width26abu-tabssimpletabsseparator-tab lih16
linr2width26abu-tabssimpletabsseparator-tab lih1 spanabu-tabssimpletabsseparator-tab6
lih1 spanabu-tabssimpletabsseparator-tab lih26
spanabu-tabssimpletabsseparator-tab lih2 spanabu-tabssimpletabsseparator-tab6
spancolor000importantborder-color400090tabads-tabpanel-ecmcenterseparator-tab selected atabads-tabpanel-ecmcenterseparator-tab6
abu-tabssimpletabsseparator-tab litab-1selectedborder-left-colord6d6d6tabads-tabpanel-ecmcenter atabads-tabpanel-ecmcenter6
selected separatorabu-tabssimpletabsseparator-tab selectedli6
separatorabu-tabssimpletabsseparator-tab selected separatorabu-tabssimpletabsseparator-tab6
separatorabu-tabssimpletabsseparator-tab selectedli separatorabu-tabssimpletabsseparator-tab6
selectedli separatorabu-tabssimpletabsseparator-tab tab-16
separatorabu-tabssimpletabsseparator-tab tab-1 separatorborder-left-colortransparentecbestbuy-tabmargin-left12padding-left36pxborder-left1px6
tab-1 separatorabu-tabssimpletabsseparator-tab selected6
selectedli separatortabads-tabpanel-ecmcenterseparator-tab tab-16
d6d6d6positionabsoluteleft0padding8px 0padding-bottom0padding-bottom0tabads-tabpanel-ecmcenterseparator-tab selected6
0padding-bottom0padding-bottom0tabads-tabpanel-ecmcenterseparator-tab selected separatortabads-tabpanel-ecmcenterseparator-tab6
selected separatortabads-tabpanel-ecmcenterseparator-tab selectedli6
separatortabads-tabpanel-ecmcenterseparator-tab selectedli separatortabads-tabpanel-ecmcenterseparator-tab6
tab-1 separatorborder-left-colortransparentecbestbuy-tabmargin-left12padding-left36pxborder-left1px solid6
separatorborder-left-colortransparentecbestbuy-tabmargin-left12padding-left36pxborder-left1px solid ecececseparator-tab6
ecbestbuy-tab tab-header-iconseparator-tab ecbestbuy-tabcount-down6
tab-header-iconseparator-tab ecbestbuy-tabcount-down tab-header-promodisplaynoneecbestbuy-tab6
ecbestbuy-tabcount-down tab-header-promodisplaynoneecbestbuy-tab tab-header-iconbackground-repeatno-repeatbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepngbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuy-tab6
tab-header-promodisplaynoneecbestbuy-tab tab-header-iconbackground-repeatno-repeatbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepngbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuy-tab tab-header-iconpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackground-position06
tab-header-icontop7pxtop10pxleft4pxseparator-tab ecbestbuy-tab tab-header-iconseparator-tab6
ecbestbuy-tab tab-header-icontop7pxtop10pxleft4pxseparator-tab ecbestbuy-tab6
solid ecececseparator-tab ecbestbuy-tabmargin-left0padding-left0separator-tab6
selected atabads-tabpanel-ecmcenterseparator-tab selected6
ecececseparator-tab ecbestbuy-tabmargin-left0padding-left0separator-tab ecbestbuy-tab6
ecbestbuy-tabmargin-left0padding-left0separator-tab ecbestbuy-tab tab-header-icontop7pxtop10pxleft4pxseparator-tab6
solid d6d6d6positionabsoluteleft0padding8px 0padding-bottom0padding-bottom0tabads-tabpanel-ecmcenterseparator-tab6
separatortabads-tabpanel-ecmcenterseparator-tab tab-1 separatorabu-tabssimpletabsseparator-tab6
abu-tabssimpletabsseparator-tab selectedright abu-tabssimpletabsseparator-tab6
separatorborder-left1px solid d6d6d6positionabsoluteleft0padding8px6
selectedright abu-tabssimpletabsseparator-tab selected6
abu-tabssimpletabsseparator-tab selected aright6
selected aright abu-tabssimpletabsseparator-tab6
selected spancolor7300ffimportantborder-colord6d6d6border-top-color7300ffbackground-colorfffright abu-tabssimpletabsseparator-tab6
aabu-tabssimpletabsseparator-tab selected spancolor7300ffimportantborder-colord6d6d6border-top-color7300ffbackground-colorfffright6
atabads-tabpanel-ecmcenterseparator-tab selected spanabu-tabssimpletabsseparator-tab6
selected spanabu-tabssimpletabsseparator-tab selected6
spanabu-tabssimpletabsseparator-tab selected aabu-tabssimpletabsseparator-tab6
selected aabu-tabssimpletabsseparator-tab selected6
aright abu-tabssimpletabsseparator-tab selected6
spancolor7300ffimportantborder-colord6d6d6border-top-color7300ffbackground-colorfffright abu-tabssimpletabsseparator-tab selectedright6
abu-tabssimpletabsseparator-tab selectedlast spanborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab6
spanborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab separatorabu-tabssimpletabsseparator-tab separatorborder-left1px6
separatorabu-tabssimpletabsseparator-tab separatorborder-left1px solid6
abu-tabssimpletabsseparator-tab selected spanbackground-colorfafaffright6
aright abu-tabssimpletabsseparator-tab selectedlast6
selectedlast spanborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab separatorabu-tabssimpletabsseparator-tab6
spanbackground-colorfafaffright abu-tabssimpletabsseparator-tab selectedlast6
abu-tabssimpletabsseparator-tab selectedlast aright6
selected spanbackground-colorfafaffright abu-tabssimpletabsseparator-tab6
selectedlast aright abu-tabssimpletabsseparator-tab6
var url ifurl5
urlsearchhttp -1documentwrite var5
height 3s ease5
stream vv-carousel li5
paldo budae jigae4
carjen nyonya curry4
budae jigae ramyun4
bodytag documentgetelementsbytagnamebody0 bodytagclassname4
price of 4gb4
var bodytag documentgetelementsbytagnamebody04
s8 with 20gb4
samsung galaxy s84
mykualithe ramen rater4
0 9px 04
rgba000065 0rgba0000 1004
rgba0000 0rgba000065 1004
windowperformance windowperformancenow var3
windowperformancenow var ltime3
if windowperformance windowperformancenow3
var ltime windowperformancenow3
microsoft jhenghei sans-serif3
requires af-transport path3
requires node path3
var w window3
stheiti microsoft jhenghei3
arial stheiti microsoft3
4g uk data3
neue helvetica arial3
0rgba0000 100 background3
vodafone uk sponsored3
uk sponsored xe0803
0rgba000065 100 background3
helvetica arial stheiti3
fdbon 1 fdbexp3
1rgba0000 20rgba000960
requires path24
ifurl urlsearchhttp16
urlsearchhttp -1documentwrite16
url ifurl16
10386363606pxmedia screen14
100background-webkit-gradientlinearleft topleft13
20rgba0009 100background-webkit-gradientlinearleft13
20rgba0009 100background-o-linear-gradienttoprgba000013
20rgba0009 100background-ms-linear-gradienttoprgba000013
20rgba0009 100filterprogiddximagetransformmicrosoftgradient13
listmargin-bottom4pxmargin-bottomcalc68181818 10386363606pxmedia13
endcolorstre6000000 gradienttype013
startcolorstr00000000 endcolorstre600000013
100filterprogiddximagetransformmicrosoftgradient startcolorstr0000000013
20rgba0009 100backgroundlinear-gradientto13
100backgroundlinear-gradientto bottomrgba000013
topleft bottomcolor-stop1rgba0000color-stop20rgba0000color-stop100rgba0009background-webkit-linear-gradienttoprgba000012
bottomrgba0000 1rgba000012
abu-tabssimpletabsseparator-tab selected12
solid transparenttabads-tabpanel-ecmcenterseparator-tab12
100background-ms-linear-gradienttoprgba0000 1rgba000012
aright abu-tabssimpletabsseparator-tab12
bottomcolor-stop1rgba0000color-stop20rgba0000color-stop100rgba0009background-webkit-linear-gradienttoprgba0000 1rgba000012
abu-tabssimpletabsseparator-tab selectedlast12
100background-o-linear-gradienttoprgba0000 1rgba000012
ecm-small overlay-wordsecm-small12
stream vv-carousel11
100 background8
ramen rater8
labelwidth38862559241ecm-default listmargin-bottom4pxmargin-bottomcalc681818187
sponsored xe0807
item labelwidth38862559241ecm-default7
137714285892pxecm-default item7
galaxy s87
listfont-size12pxmargin-bottom5pxmedia screen7
separatorborder-left1px solid7
itemmargin-bottom4pxmargin-bottomcalc285714286 137714285892pxecm-default7
ulmargin-right-8pxutil-lifeads wrapheight134pxutil-brandads6
ad-travelwrapwidth104pxoverflow-xhiddenutil-travelads ad-travel6
logowidth100pxheight65pxmargin-bottom3pxutil-lifeads ulmargin-right-8pxutil-lifeads6
wrapheight134pxutil-brandads brandads-containermargin-right-10pxutil-brandads6
ad-travel logowidth100pxheight65pxmargin-bottom3pxutil-lifeads6
content-textfont-size12pxecm-inner-containerisecuserpadding-bottom312796209ecm-inner-containerpadding-bottom156ec-list promote-bannermargin-top-10pxwidth315min-height187pxmin-width187pxec-list6
overlay-bannercolorffffont-size16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba0000 1rgba00006
promote-padding-blockwidth314min-width187pxheight100pxec-list overlay-bannercolorffffont-size16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba00006
promote-bannermargin-top-10pxwidth315min-height187pxmin-width187pxec-list promote-padding-blockwidth314min-width187pxheight100pxec-list6
brandads-containermargin-right-10pxutil-brandads content-textfont-size12pxecm-inner-containerisecuserpadding-bottom312796209ecm-inner-containerpadding-bottom156ec-list6
gradienttype0 ec-list6
atext-decorationnonefont-size13pxutil-travelads ad-travel6
tab-header-promodisplayinlineutil-travelads ulwidth67media6
tab-header-promocolorfc6767font-stylenormalfont-size13pxfont-size13rempadding-left3pxdisplaynoneecbestbuy-tabcount-down tab-header-promodisplayinlineutil-travelads6
ulwidth67media max-width1040pxutil-travelads6
max-width1040pxutil-travelads ulwidth64util-travelads6
ulwidth64util-travelads my-adskt7positionabsolutetop-15pxright0util-travelads6
-164pxecbestbuy-tab tab-header-promocolorfc6767font-stylenormalfont-size13pxfont-size13rempadding-left3pxdisplaynoneecbestbuy-tabcount-down6
tab-header-iconbackground-position0 -164pxecbestbuy-tab6
tab-header-iconpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackground-position0 -187pxecbestbuy-tab6
-187pxecbestbuy-tab ecbestbuy-promo-icontop-7pxleft10pxpadding06
ecbestbuy-promo-icontop-7pxleft10pxpadding0 5pxmin-width15pxheight14pxbackground-coloref4e5eecbestbuy-tabcount-down6
5pxmin-width15pxheight14pxbackground-coloref4e5eecbestbuy-tabcount-down tab-header-iconbackground-position06
my-adskt7positionabsolutetop-15pxright0util-travelads darlamargin-left-16pxutil-travelads6
darlamargin-left-16pxutil-travelads gridspreadmargin-bottom0util-travelads6
textlinkcolor324fe1white-spacenowrapoverflowhiddentext-overflowellipsisdisplayblockutil-travelads ad-travel6
ad-travel textlinkcolor324fe1white-spacenowrapoverflowhiddentext-overflowellipsisdisplayblockutil-travelads6
ad-travel textlinkhovertext-decorationunderlineutil-travelads6
textlinkhovertext-decorationunderlineutil-travelads ad-travel6
ad-travel imgborder0util-travelads6
agencycolor1e7d83width52pxmargin-right8pxfloatleftutil-travelads ad-travel6
ad-travel agencycolor1e7d83width52pxmargin-right8pxfloatleftutil-travelads6
ad-travel atext-decorationnonefont-size13pxutil-travelads6
ec-list overlay-wordspadding06
ad-travel ahovertext-decorationunderlineutil-travelads6
ahovertext-decorationunderlineutil-travelads ad-travel6
imgborder0util-travelads ad-travelwrapwidth104pxoverflow-xhiddenutil-travelads6
listfont-size12pxmargin-bottom5pxecm-halfpadding-bottom156398105ecm-half itemmargin-top10pxmargin-bottom4pxmargin-topcalc16
138pxecm-small item6
item labelwidth38862559241ecm-small6
labelwidth38862559241ecm-small listmargin-bottom4pxmargin-bottomcalc681818186
max-width1185pxecm-small overlay-wordsfont-size15pxmedia6
itemmargin-bottom4pxmargin-bottomcalc43 138pxecm-small6
need-underlinehovertext-decorationunderlineimportantecm-small itemmargin-bottom4pxmargin-bottomcalc436
overlay-wordsbottom12pxfont-size16pxbillboard ecm-small6
ecm-small overlay-wordsfont-size14pxecm-small6
overlay-wordsfont-size14pxecm-small need-underlinecolorfffimportantecm-small6
need-underlinecolorfffimportantecm-small need-underlinehovertext-decorationunderlineimportantecm-small6
overlay-wordsfont-size15pxmedia screen6
max-width1128pxecm-small overlay-wordsfont-size14pxmedia6
max-width1019pxbillboard ecm-small6
overlay-wordsecm-small overlay-wordsfont-size12px6
stream social-sharing-container6
3s ease6
max-width1043pxecm-small listfont-size12pxmargin-bottom5pxmedia6
overlay-wordsfont-size13pxmedia screen6
overlay-wordsfont-size14pxmedia screen6
max-width1072pxbillboard ecm-small6
overlay-wordsecm-small overlay-wordsfont-size13pxmedia6
ecm-small overlay-wordsbottom12pxfont-size16pxbillboard6
gradienttype0 ecm-small6
max-width1043pxecm-default listfont-size12pxmargin-bottom5pxecm-halfpadding-bottom156398105ecm-half6
tab-header-iconbackground-repeatno-repeatbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepngbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuy-tab tab-header-iconpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackground-position06
itemmargin-top10pxmargin-bottom4pxmargin-topcalc1 278pxmargin-bottomcalc16
278pxmargin-bottomcalc1 278pxecm-half6
need-underlinehovertext-decorationunderlineimportantecm-defaultpadding-bottom312796209ecm-default itemmargin-bottom4pxmargin-bottomcalc2857142866
need-underlinecolorfffimportantec-list need-underlinehovertext-decorationunderlineimportantecm-defaultpadding-bottom312796209ecm-default6
8px 06
0 8pxbottom12pxec-list6
8pxbottom12pxec-list right-ulpadding-left31ec-list6
right-ulpadding-left31ec-list need-underlinecolorfffimportantec-list6
278pxecm-half item6
item labelwidth38862559241ecm-half6
bannerecm-small banner-overlaywidth945widthcalc93756
banner-overlaywidth945widthcalc9375 39375pxecm-small6
39375pxecm-small banner-overlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba00006
banner-overlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba0000 1rgba00006
listfont-size12pxmargin-bottom5pxecm-small bannerecm-small6
max-width1043pxecm-half listfont-size12pxmargin-bottom5pxecm-small6
labelwidth38862559241ecm-half listmargin-bottom4pxmargin-bottomcalc106
listmargin-bottom4pxmargin-bottomcalc10 167pxmedia6
167pxmedia screen6
overlay-wordspadding0 8px6
gridspreadmargin-bottom0util-travelads ad-travel6
abu-tabssimpletabsseparator-tab liselectedlast-childborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab6
liselectedlast-childborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab litab-1selectedabu-tabssimpletabsseparator-tab6
litab-1selectedabu-tabssimpletabsseparator-tab litab-1selectedborder-left-colortransparentright6
litab-1selectedborder-left-colortransparentright abu-tabssimpletabsseparator-tab6
fafaffpadding-bottom1pxheight36px9height36pxright abu-tabssimpletabsseparator-tab6
solid fafaffpadding-bottom1pxheight36px9height36pxright6
solid fffmargin-bottom-1pxfont-weight700right6
fffmargin-bottom-1pxfont-weight700right abu-tabssimpletabsseparator-tab6
abu-tabssimpletabsseparator-tab liselectedborder-bottom1px6
liselectedborder-bottom1px solid6
abu-tabssimpletabsseparator-tab litab-1selectedborder-left-colord6d6d6tabads-tabpanel-ecmcenter6
litab-1selectedborder-left-colord6d6d6tabads-tabpanel-ecmcenter atabads-tabpanel-ecmcenter6
aabu-tabssimpletabsseparator-tab spancolor000importantborder-top3px6
spancolor000importantborder-top3px solid6
solid transparentborder-bottom0tabads-tabpanel-ecmcenter6
transparentborder-bottom0tabads-tabpanel-ecmcenter selected6
spanabu-tabssimpletabsseparator-tab aabu-tabssimpletabsseparator-tab6
atabads-tabpanel-ecmcenterseparator-tab spanabu-tabssimpletabsseparator-tab6
atabads-tabpanel-ecmcenter spancolor5f5f5fimportantborder-bottom4px6
spancolor5f5f5fimportantborder-bottom4px solid6
transparenttabads-tabpanel-ecmcenterseparator-tab atabads-tabpanel-ecmcenterseparator-tab6
liselectedborder-colord6d6d6border-bottom1px solid6
liselectedabu-tabssimpletabsseparator-tab liselectedborder-colord6d6d6border-bottom1px6
liborder-right1px solid6
solid transparentborder-left1px6
transparentborder-left1px solid6
transparenttabads-tabpanel-ecmcenterseparator-tab liwidth16tabads-tabpanel-ecmcenterseparator-tab6
liabu-tabssimpletabsseparator-tab liborder-right1px6
abu-fz-mfont-size14pxfont-size14remseparator-tabbackground-colorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabads-tabpanel-ecmcenterseparator-tab liabu-tabssimpletabsseparator-tab6
0pphw-panel pp-u6
-1documentwrite abu-fz-mfont-size16pxfont-size16remsmall-size6
abu-fz-mfont-size16pxfont-size16remsmall-size abu-fz-mfont-size14pxfont-size14remseparator-tabbackground-colorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabads-tabpanel-ecmcenterseparator-tab6
liwidth16tabads-tabpanel-ecmcenterseparator-tab promo-adline-height33pxcolor00fimportantright8pxtabads-tabpanel-ecmcenterseparator-tab6
promo-adline-height33pxcolor00fimportantright8pxtabads-tabpanel-ecmcenterseparator-tab promo-adhovertext-decorationunderlineabu-tabssimpletabsseparator-tab6
lih2 spanabu-tabssimpletabsseparator-tab6
spanabu-tabssimpletabsseparator-tab lih36
lih3 spanfont-size15pxtabads-tabpanel-ecmcenterseparator-tab6
spanfont-size15pxtabads-tabpanel-ecmcenterseparator-tab liselectedabu-tabssimpletabsseparator-tab6
spanabu-tabssimpletabsseparator-tab lih26
lih1 spanabu-tabssimpletabsseparator-tab6
promo-adhovertext-decorationunderlineabu-tabssimpletabsseparator-tab liwidth23abu-tabssimpletabsseparator-tab6
liwidth23abu-tabssimpletabsseparator-tab linr2width26abu-tabssimpletabsseparator-tab6
tab-header-promodisplaynoneecbestbuy-tab tab-header-iconbackground-repeatno-repeatbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepngbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuy-tab6
selected atabads-tabpanel-ecmcenter6
linr2width26abu-tabssimpletabsseparator-tab lih16
separatorabu-tabssimpletabsseparator-tab selected6
selected separatorabu-tabssimpletabsseparator-tab6
separatorabu-tabssimpletabsseparator-tab selectedli6
selectedli separatorabu-tabssimpletabsseparator-tab6
tab-1 separatorabu-tabssimpletabsseparator-tab6
separatortabads-tabpanel-ecmcenterseparator-tab tab-16
atabads-tabpanel-ecmcenter selected6
separatortabads-tabpanel-ecmcenterseparator-tab selectedli6
selectedli separatortabads-tabpanel-ecmcenterseparator-tab6
separatorabu-tabssimpletabsseparator-tab tab-16
tab-1 separatorborder-left-colortransparentecbestbuy-tabmargin-left12padding-left36pxborder-left1px6
tab-header-icontop7pxtop10pxleft4pxseparator-tab ecbestbuy-tab6
ecbestbuy-tab tab-header-iconseparator-tab6
tab-header-iconseparator-tab ecbestbuy-tabcount-down6
ecbestbuy-tabcount-down tab-header-promodisplaynoneecbestbuy-tab6
ecbestbuy-tab tab-header-icontop7pxtop10pxleft4pxseparator-tab6
ecbestbuy-tabmargin-left0padding-left0separator-tab ecbestbuy-tab6
separatorborder-left-colortransparentecbestbuy-tabmargin-left12padding-left36pxborder-left1px solid6
solid ecececseparator-tab6
ecececseparator-tab ecbestbuy-tabmargin-left0padding-left0separator-tab6
0padding-bottom0padding-bottom0tabads-tabpanel-ecmcenterseparator-tab selected6
selected separatortabads-tabpanel-ecmcenterseparator-tab6
selected aabu-tabssimpletabsseparator-tab6
aabu-tabssimpletabsseparator-tab selected6
selected spancolor7300ffimportantborder-colord6d6d6border-top-color7300ffbackground-colorfffright6
d6d6d6positionabsoluteleft0padding8px 0padding-bottom0padding-bottom0tabads-tabpanel-ecmcenterseparator-tab6
spanabu-tabssimpletabsseparator-tab selected6
selected spanabu-tabssimpletabsseparator-tab6
selected spancolor000importantborder-color400090tabads-tabpanel-ecmcenterseparator-tab6
spancolor000importantborder-color400090tabads-tabpanel-ecmcenterseparator-tab selected6
selected atabads-tabpanel-ecmcenterseparator-tab6
atabads-tabpanel-ecmcenterseparator-tab selected6
abu-tabssimpletabsseparator-tab selectedright6
spancolor7300ffimportantborder-colord6d6d6border-top-color7300ffbackground-colorfffright abu-tabssimpletabsseparator-tab6
selectedright abu-tabssimpletabsseparator-tab6
spanborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab separatorabu-tabssimpletabsseparator-tab6
separatorabu-tabssimpletabsseparator-tab separatorborder-left1px6
solid d6d6d6positionabsoluteleft0padding8px6
selectedlast aright6
selectedlast spanborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab6
selected aright6
selected spanbackground-colorfafaffright6
spanbackground-colorfafaffright abu-tabssimpletabsseparator-tab6
height 3s5
vv-carousel li5
windowperformance windowperformancenow5
-1documentwrite var5
stream splashtopsticky5
var url5
0rgba0000 20rgba00095
budae jigae4
jigae ramyun4
mykualithe ramen4
paldo budae4
nyonya curry4
uh yui3-aclist4
carjen nyonya4
20gb data4
no upfront4
bodytag documentgetelementsbytagnamebody04
documentgetelementsbytagnamebody0 bodytagclassname4
9px 04
var bodytag4
ltime windowperformancenow4
windowperformancenow var4
0 9px4
if windowperformance4
0 04
samsung galaxy4
new dategettime4
rgba000065 0rgba00004
0rgba0000 1004
0rgba000065 1004
rgba0000 0rgba0000654
pp-u active4
none stream4
stream js-stream-featured-ad4
pp-u hover4
af-transport path3
var ltime3
yuiusenode-base functiony3
var w3
w window3
undefined var3
neue helvetica3
requires node3
function var3
arial stheiti3
requires af-transport3
node path3
meta y3
helvetica arial3
4g uk3
stheiti microsoft3
display block3
jhenghei sans-serif3
microsoft jhenghei3
uk data3
vodafone uk3
find out3
fdbon 13
display none3
1 var3
uk sponsored3
5px stream3
1 fdbexp3
086
var77
20rgba000965
solid64
selected63
1rgba000060
requires60
path60
if51
stream50
abu-tabssimpletabsseparator-tab48
screen47
145
ad-travel42
spanabu-tabssimpletabsseparator-tab24
separatorabu-tabssimpletabsseparator-tab24
ecm-small24
function20
item19
url16
-29pxintlselector16
ifurl16
-1documentwrite16
urlsearchhttp16
data16
-15pxintlselector16
background15
pp-u15
new14
10386363606pxmedia14
true14
startcolorstr0000000014
-43pxintlselector14
214
height14
false14
-1pxintlselector14
topleft13
100background-o-linear-gradienttoprgba000013
100background-webkit-gradientlinearleft13
uh13
listmargin-bottom4pxmargin-bottomcalc6818181813
100filterprogiddximagetransformmicrosoftgradient13
endcolorstre600000013
100backgroundlinear-gradientto13
bottomrgba000013
100background-ms-linear-gradienttoprgba000013
selectedli13
gradienttype013
atabads-tabpanel-ecmcenter12
overlay-wordsecm-small12
atabads-tabpanel-ecmcenterseparator-tab12
transparenttabads-tabpanel-ecmcenterseparator-tab12
aright12
tab-112
separatortabads-tabpanel-ecmcenterseparator-tab12
ecbestbuy-tab12
aabu-tabssimpletabsseparator-tab12
bottomcolor-stop1rgba0000color-stop20rgba0000color-stop100rgba0009background-webkit-linear-gradienttoprgba000012
selectedlast12
windowperformancenow12
vv-carousel11
ad11
yahoo9
top9
0rgba00009
position9
tabs8
pp-gf8
background-color8
38
75s8
uk8
s88
ramen8
rater8
galaxy8
display7
user-info7
8px7
itemmargin-bottom4pxmargin-bottomcalc2857142867
none7
max-width1043pxecm-default7
listfont-size12pxmargin-bottom5pxmedia7
137714285892pxecm-default7
labelwidth38862559241ecm-default7
social-sharing-container7
j7
xe0807
0pphw-panel7
you7
return7
upfront7
1px7
y7
separatorborder-left1px7
positem7
sponsored7
navlist7
stencil7
ease7
size7
0px7
listfont-size12pxmargin-bottom5pxecm-halfpadding-bottom156398105ecm-half6
278pxmargin-bottomcalc16
windowperformance6
167pxmedia6
listmargin-bottom4pxmargin-bottomcalc106
labelwidth38862559241ecm-half6
278pxecm-half6
itemmargin-top10pxmargin-bottom4pxmargin-topcalc16
need-underlinehovertext-decorationunderlineimportantecm-defaultpadding-bottom312796209ecm-default6
promote-padding-blockwidth314min-width187pxheight100pxec-list6
overlay-bannercolorffffont-size16pxheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba00006
expires6
promote-bannermargin-top-10pxwidth315min-height187pxmin-width187pxec-list6
content-textfont-size12pxecm-inner-containerisecuserpadding-bottom312796209ecm-inner-containerpadding-bottom156ec-list6
wrapheight134pxutil-brandads6
brandads-containermargin-right-10pxutil-brandads6
ec-list6
overlay-wordspadding06
bodytagclassname6
e6
max-width1043pxecm-half6
need-underlinecolorfffimportantec-list6
8pxbottom12pxec-list6
right-ulpadding-left31ec-list6
curad6
39375pxecm-small6
overlay-wordsfont-size12px6
js-stream-featured-ad6
max-width1019pxbillboard6
max-width1043pxecm-small6
max-width1072pxbillboard6
overlay-wordsfont-size13pxmedia6
4gb6
price6
width6
ulmargin-right-8pxutil-lifeads6
3s6
right6
rgba0000656
rgba00006
overlay-wordsfont-size14pxmedia6
max-width1128pxecm-small6
mykuali6
overlay-wordsbottom12pxfont-size16pxbillboard6
banner-overlaycolorfffheight100pxbackgroundurldataimagesvgxmlbase64pd94bwwgdmvyc2lvbj0ims4wiiapgo8c3znihhtbg5zpsjodhrwoi8vd3d3lnczlm9yzy8ymdawl3n2zyigd2lkdgg9ijewmcuiighlawdodd0imtawjsigdmlld0jved0imcawidegmsigchjlc2vydmvbc3bly3rsyxrpbz0ibm9uzsiciagpgxpbmvhckdyywrpzw50iglkpsjncmfklxvjz2ctz2vuzxjhdgvkiibncmfkawvudfvuaxrzpsj1c2vyu3bhy2vpblvzzsigede9ijaliib5mt0imcuiihgypsiwjsigeti9ijewmcuipgogicagphn0b3agb2zmc2v0psixjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijiwjsigc3rvcc1jb2xvcj0iizawmdawmcigc3rvcc1vcgfjaxr5psiwii8ciagica8c3rvccbvzmzzzxq9ijewmcuiihn0b3aty29sb3i9iimwmdawmdaiihn0b3atb3bhy2l0et0imc45ii8ciagpc9saw5lyxjhcmfkawvudd4kica8cmvjdcb4psiwiib5psiwiib3awr0ad0imsigagvpz2h0psixiibmawxspsj1cmwoi2dyywqtdwnnzy1nzw5lcmf0zwqpiiavpgo8l3n2zz4background-moz-linear-gradienttoprgba00006
banner-overlaywidth945widthcalc93756
curry6
bannerecm-small6
overlay-wordsfont-size14pxecm-small6
need-underlinecolorfffimportantecm-small6
labelwidth38862559241ecm-small6
max-width1185pxecm-small6
out6
138pxecm-small6
need-underlinehovertext-decorationunderlineimportantecm-small6
itemmargin-bottom4pxmargin-bottomcalc436
listfont-size12pxmargin-bottom5pxecm-small6
overlay-wordsfont-size15pxmedia6
liselectedborder-bottom1px6
fafaffpadding-bottom1pxheight36px9height36pxright6
liselectedlast-childborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab6
fffmargin-bottom-1pxfont-weight700right6
liselectedborder-colord6d6d6border-bottom1px6
lih36
spanfont-size15pxtabads-tabpanel-ecmcenterseparator-tab6
liselectedabu-tabssimpletabsseparator-tab6
litab-1selectedabu-tabssimpletabsseparator-tab6
litab-1selectedborder-left-colortransparentright6
spancolor000importantborder-color400090tabads-tabpanel-ecmcenterseparator-tab6
spancolor7300ffimportantborder-colord6d6d6border-top-color7300ffbackground-colorfffright6
selectedright6
transparentborder-bottom0tabads-tabpanel-ecmcenter6
spancolor000importantborder-top3px6
litab-1selectedborder-left-colord6d6d6tabads-tabpanel-ecmcenter6
spancolor5f5f5fimportantborder-bottom4px6
lih26
lih16
li6
46
56
color6
hover6
ad-tl2b6
logowidth100pxheight65pxmargin-bottom3pxutil-lifeads6
04000906
abu-fz-mfont-size16pxfont-size16remsmall-size6
liabu-tabssimpletabsseparator-tab6
promo-adhovertext-decorationunderlineabu-tabssimpletabsseparator-tab6
liwidth23abu-tabssimpletabsseparator-tab6
linr2width26abu-tabssimpletabsseparator-tab6
promo-adline-height33pxcolor00fimportantright8pxtabads-tabpanel-ecmcenterseparator-tab6
liwidth16tabads-tabpanel-ecmcenterseparator-tab6
liborder-right1px6
transparentborder-left1px6
spanbackground-colorfafaffright6
abu-fz-mfont-size14pxfont-size14remseparator-tabbackground-colorf2f2f4clearfixafterclearbothcontentdisplayblockheight0visibilityhiddentabads-tabpanel-ecmcenterseparator-tab6
ulwidth67media6
agencycolor1e7d83width52pxmargin-right8pxfloatleftutil-travelads6
textlinkhovertext-decorationunderlineutil-travelads6
tab-header-promodisplayinlineutil-travelads6
-164pxecbestbuy-tab6
5pxmin-width15pxheight14pxbackground-coloref4e5eecbestbuy-tabcount-down6
tab-header-iconbackground-position06
max-width1040pxutil-travelads6
ulwidth64util-travelads6
atext-decorationnonefont-size13pxutil-travelads6
ad-travelwrapwidth104pxoverflow-xhiddenutil-travelads6
ahovertext-decorationunderlineutil-travelads6
textlinkcolor324fe1white-spacenowrapoverflowhiddentext-overflowellipsisdisplayblockutil-travelads6
gridspreadmargin-bottom0util-travelads6
my-adskt7positionabsolutetop-15pxright0util-travelads6
darlamargin-left-16pxutil-travelads6
ecbestbuy-promo-icontop-7pxleft10pxpadding06
tab-header-promocolorfc6767font-stylenormalfont-size13pxfont-size13rempadding-left3pxdisplaynoneecbestbuy-tabcount-down6
tab-header-icontop7pxtop10pxleft4pxseparator-tab6
tab-header-iconseparator-tab6
ecbestbuy-tabcount-down6
ecececseparator-tab6
separatorborder-left-colortransparentecbestbuy-tabmargin-left12padding-left36pxborder-left1px6
spanborder-right-colortransparenttabads-tabpanel-ecmcenterseparator-tab6
d6d6d6positionabsoluteleft0padding8px6
0padding-bottom0padding-bottom0tabads-tabpanel-ecmcenterseparator-tab6
tab-header-promodisplaynoneecbestbuy-tab6
ecbestbuy-tabmargin-left0padding-left0separator-tab6
-187pxecbestbuy-tab6
tab-header-iconbackground-repeatno-repeatbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepngbackground-imageurlhttpssyimgcomudhphrsprites20140910spritepng8pngecbestbuy-tab6
tab-header-iconpositionabsolutetop8pxleft8pxwidth25pxheight22pxbackground-position06
imgborder0util-travelads6
2px5
z-index5
setncom5
m5
name5
splashtopsticky5
lang5
no5
curadclassname5
locales5
best5
undefined5
0rgba25525525505
zh-hant-tw5
transform5
null5
5px5
left5
translatez05
fff5
ltime5
more4
ymedia4
12px4
64
util-weather4
documentgetelementsbytagnamebody04
bodytag4
find4
ramyun4
mykualithe4
try4
jigae4
lienesch4
get4
default4
unlimited4
samsung4
budae4
paldo4
helvetica4
arial4
hans4
neue4
straits4
nyonya4
carjen4
ifmsgname4
loaddefaultbundle4
mathroundltime4
videoplayingvideoplaylistweatherapptitleweatherdownloadappyahooappweatherlatestupdateweathermoreinformationweathertodayweathertomorrowhpsetmakehpsetyourhomepagesponsoredsuggestionsuggestionshortautoplaydefaultonofftventrytvtransportxhrtdapicontextbucket235devicedesktoplangzh-hant-twregiontwsitefp4
mailboxesid4
border-radius4
opacity4
important4
0rgba0000654
74
datrk4
active4
media4
yui3-aclist4
dategettime4
w4
84
margin-top4
translatey-97px4
translatey-42px4
else4
abu-today4
img4
yui3-widget-ft4
windowismodalopen4
11px4
modlangbundlesexpanded4
eyebrow4
r4
boiler4
20gb4
9px4
sans-serif4
typeof3
posid3
d3
6px3
pagemode3
one3
functiony3
yuiusenode-base3
pphw-cleanbtnbackground-position-258px3
af-transport3
laptop3
something3
pphw-undobtnbackground-position-258px3
initialpageload3
we3
node3
rapidconfig3
back3
settimeoutfunction3
possize3
visible3
-1px3
fallbacktargetnode3
fallbackhtmlcontent3
posdata3
adindex3
jhenghei3
-webkit-transform3
-moz-transform3
story-item3
js-stream-content3
block3
93
-ms-transform3
40px3
days3
microsoft3
money3
3px3
12gb3
padding3
103
filter3
line-height3
border-bottom3
113
f1f1f1stencil3
4px3
123
28px3
hidden3
padding-right3
14px3
font-size3
auto3
vauxhall3
always3
eng3
singapore3
meta3
id3
line3
canada3
133
fdbon3
tv3
window3
error3
fdbintl3
fdbexp3
need3
over3
kitchen3
143
153
stheiti3
looking3
4g3
10px3
citron3
save3
163
vodafone3
mins3
di3

What are the nameservers for yahoo.com.tw?

Yahoo.com.tw Domain Nameserver Information

HostIP AddressCountry
ns2.yahoo.com 68.142.255.16United States United States
ns4.yahoo.com 98.138.11.157United States United States
ns3.yahoo.com 203.84.221.53Hong Kong SAR China Hong Kong SAR China
ns1.yahoo.com 68.180.131.16United States United States
ns5.yahoo.com 119.160.247.124Taiwan Taiwan

Yahoo.com.tw Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yahoo.com.tw is a scam?