Yahoo France | Actualités, mail et recherche

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: 46,463
Estimated Worth: $351,360
Category: News and Media

Actualités, sport, people et lifestyle : le meilleur de l'info en un clic.



Domain summary

Last updated
2020-10-15
Domain label
yahoo
Domain extension
fr
Domain registered:
1996-09-19
Domain updated:
2020-05-19
Global Traffic Rank
46,463
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$351,360
Estimated daily income
$488
Estimated monthly income
$14,843

Rank summary

How is yahoo.fr ranked relative to other sites:

Percentage of visits to yahoo.fr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Yahoo.fr registered?
A: Yahoo.fr was registered 24 years, 7 months, 1 day, 23 hours, 36 minutes, 32 seconds ago on Thursday, September 19, 1996.
Q: When was the WHOIS for Yahoo.fr last updated?
A: The WHOIS entry was last updated 11 months, 1 day, 23 hours, 36 minutes, 32 seconds ago on Tuesday, May 19, 2020.
Q: What are Yahoo.fr's nameservers?
A: DNS for Yahoo.fr is provided by the following nameservers:
  • ns7.yahoo.com
Q: Who is the registrar for the Yahoo.fr domain?
A: The domain has been registered at AFNIC.
Q: What is the traffic rank for Yahoo.fr?
A: Yahoo.fr ranks 46,463 globally on Alexa. Yahoo.fr has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Yahoo.fr each day?
A: Yahoo.fr receives approximately 40,660 visitors and 243,960 page impressions per day.
Q: What IP address does Yahoo.fr resolve to?
A: Yahoo.fr resolves to the IPv4 address 74.6.136.150.
Q: In what country are Yahoo.fr servers located in?
A: Yahoo.fr has servers located in the United States.
Q: What webserver software does Yahoo.fr use?
A: Yahoo.fr is powered by ATS webserver.
Q: Who hosts Yahoo.fr?
A: Yahoo.fr is hosted by Yahoo! in United States.
Q: How much is Yahoo.fr worth?
A: Yahoo.fr has an estimated worth of $351,360. An average daily income of approximately $488, which is roughly $14,843 per month.

Yahoo.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yahoo.fr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yahoo.fr

H1 Headings

1 :
  1. dossiers

H2 Headings

3 :
  1. Les dernières infos sur la recrudescence de Covid-19
  2. Une altercation à l'origine du meurtre de Victorine ?
  3. Coronavirus : les dernières infos

H3 Headings

15 :
  1. Covid : le nombre de nouveaux cas bat un record
  2. "On nous prend vraiment pour des cons"
  3. Policier percuté : une information judiciaire ouverte
  4. Ce célèbre dicton qu'il faut éviter de répéter à sa fille
  5. Cette pratique parfois jugée honteuse serait bénéfique
  6. Johnny Hallyday : sa terrible prédiction concernant Laeticia avant de mourir
  7. Publicité Transform Your Life From Your Morning Coffee On
  8. Adil Rami explique pourquoi il a été « obligé » de mener une double vie entre Pamela Anderson et Sidonie Biémont
  9. Une "dispute" après une "bousculade": la version du suspect sur la mort de Victorine Dartois
  10. Mort de Victorine: le suspect a été arrêté grâce au "témoignage d'un proche"
  11. Publicité Get your glow on
  12. Un garde du corps d’Emmanuel Macron pris la main dans le sac en galante compagnie
  13. Les fêtes privées, mariages comme soirées étudiantes, interdites partout
  14. Un jaguar brûlé aux pattes sauvé des flammes au Pantanal
  15. Météo

H4 Headings

2 :
  1. Tendances du jour
  2. Londres

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

29 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

22:

Links - Internal (nofollow)

0:

Links - Outbound

49:

Links - Outbound (nofollow)

11:

Keyword Cloud for Yahoo.fr

20459933223nypubblobsoincreaseexpovrversionadmaxadclientvarnewlesdfunction logbfunction arecookiesenabledvaradmaxadclientegetaddfunctionif yahoopositemsize 1x1positemmetapanelactivexobjectmicrosoftxmlhttpfunction includejscjdvarifhas 2 exclusiveadmaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar239808051nbrxdpublisheridsurddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvardnew admaxclientdadmaxadparamsfunctiontypeofjcvar gdocumentcookiesplitforvarpositionle suspectreturn void keyadspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinningincludejscjdvar gmathfloormathrandom1000000varpreviousadwasmon2gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001returnvisibleif yahoo yahooi13ncontractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning group haspas cetteaft2 startwindowrequiredselfconfigbadgehideclassnavigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction readcookiecifdocumentcookievar jcvarviewadserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunctionheightvar bodytagyahoo yahooi13nitsnaimeorigwidthgroup has 2poseventnamestarttelsedforighiescapegireturnexclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinningbrxd4452051nyadposnavigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction0 lrec3divclassnamenwdadsconfigbelsecreatecookienexagesd1001return 1return nullnvarif eventnamecreatepanelparentnodehttpsfryahoocomnsecurek0k10return0createcookienexagesdb001returndirectementdocumentgetelementsbytagnamebody0 bodytagclassnamedarlaonreadygmathfloormathrandom1000000var badgvarexclusivegdocumentcookiesplitforvar k0k10return0createcookienexagesdb001returnlannoncecollapseru00e9duirefdbje naimepositemconf positemconfcleanwindowperformancenow var ltimegetsuidnvardnvoid keyadmaxclientdadmaxadparamsfunctionbodytag documentgetelementsbytagnamebody0value functionbmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavarhactagthisdividfori in ghiescapegireturnvar wcgetsdifcparamssdcvar dnewpuburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer lannoncecollapseru00e9duirefdbje naimeuneresetbadgesa puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermerxmlhttprequestelsereturnnavigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction readcookiecifdocumentcookievaraft2vardans leaft2startrenderfunctioneventnameadmaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvarhthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavarreadcookiecifdocumentcookievar jcvarweadtimeapiurlhttpsoaojstagonemobileyahoocomadmaxadmaxapidovargetsuidnvar admaxvarsencodeparamscvar dforiifmsgnameposidbnavigatorcookieenabledtruefalseiftypeofwe askbelsecreatecookienexagesd1001returngmathfloormathrandom1000000var badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunctionleassignhelpermethodsadserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunction admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavarfemmevictorineadmaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvarpositemparamsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvarnew xmlhttprequestelsereturn newnumbernew datemsgnamekscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvaryahootimeoutnew xmlhttprequestelsereturn0 lrec4divclassnameconfigsetarecookiesenabledvarvar selfwindowdarlalogrenderfailure function905nusprivacyrapidinstance1nbrxdsiteid 4452051ndcnkey1return nullnvaradspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning groupgardeadidactionindexofadstartlannoncecollapseru00e9duirefdbjeyahooi13nbmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvarhasif windowperformance windowperformancenowlrec3divparentelementclassnameadserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunction admaxadclientvarstyletaglrec4divlannoncecollapseru00e9duirefdbje naime pasactivexobjectmicrosoftxmlhttpfunction includejscjdvar gmathfloormathrandom1000000varnationscetteparamsfunctionpositemsizesondansnaime pas cette3nybkt 905nusprivacyyathisbuildrequesturladserveurldthisrenderadavar paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvarnewwidthquifgetsdiffdsdfvar enewbadgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvarathisbuildrequesturladserveurldthisrenderadavar paramsfunctiondocumentgetelementbyidpositemconfclean ifadmaxvarspanelcontroller3nybktencodeparamscvarcanwindowperformancedoradodocumentgetelementbyidpositemconfcleanadmaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvarenew admaxadclientegetaddfunctionymediafalseapiurlhttpsoaojstagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunctionhas 1 exclusiveself1return nullnvar suidkscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar dforilogbfunction arecookiesenabledvarparamsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvare1 varkscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunctionif typeofsa puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer lannoncecollapseru00e9duirefdbjecgetsdifcparamssdcvarwperformancenowonlyif ismon2validnew xdomainrequestelsereturnincludejscjdvar gmathfloormathrandom1000000var badgvarlexppushlrec3divdn ifyoupositemconfshowbadgecuradyaft905nusprivacy nwdundefinedreturnadmaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar enewadactionpublicitu00e9showadafficherask1 exclusivepositemconfclean1nbrxdsiteid 4452051ndcn brxd4452051nyadposhttpsfryahoocomnsecure 1nbrxdsiteid3renderdefaultconfigymediamyappgetrapidtrackerpouradtimingdfunction logbfunctionmeurtrebodytagclassnamepuburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermerfunctionif typeof windowdarlalogrenderfailurepas cette publicitu00e9showadaffichergetnew activexobjectmicrosoftxmlhttpfunctionnumbernewconfighactagthisdividforinull if1returnvar ltime windowperformancenowsuidltime windowperformancenowfunction if windowperformanceyahooi13nrapidinstanceapiurlhttpsoaojstagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoaojstagonemobileyahoocomadmaxadservedofunction admaxadclientvarbadgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunctionfgetsdiffdsdfvaradidgetxmlhttprequestifwindowxmlhttprequestiftypeofarecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunctionstylesnbrxdsectionid 239808051nbrxdpublisheridadindexfunction ifadtimeaft2diffafterpageloadismon2validconcernantif posnamesanew activexobjectmicrosoftxmlhttpfunction includejscjdvarvoidadmaxadcallbackparamsuanavigatoruseragentparamsofjsvarfgetsdiffdsdfvar enew admaxadclientegetaddfunctionenewxdomainrequestelsereturn new xmlhttprequestelsereturnhas 2httpsfryahoocomnsecure 1nbrxdsiteid 4452051ndcnbnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunction readcookiecifdocumentcookievarnewheightvalidaterequiredconfigsadif windowperformancestoreexclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning groupcontractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinningpageparamsobjectbnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx1truefalsereturnbfunctionpositemhaserr positemsize 1x1bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividforisuid getsuidnvar admaxvarstypeof windowdarlalogrenderfailurehas 1badgeplus1puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer lannoncecollapseru00e9duirefdbjexmlhttprequestelsereturn newxdomainrequestundefinedreturn newgetxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn new2 exclusivegmathfloormathrandom1000000varnotificationsvosdfori in cdiescapecireturntypeof windowdarlalogrenderfailure functionbodytag documentgetelementsbytagnamebody0 bodytagclassname4windowperformance windowperformancenowvar ltimereadcookiecifdocumentcookievarxdomainrequestelsereturn newmathroundwindowperformancenownullsuspectunselfstoreilmastghiescapegireturn hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavark0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return 1returnwperformanceghiescapegireturn hthisgetadfunctiondvarshowindicatorpositemhaserr positemsizewindowperformancenowparam1nbrxdsiteidlrec3divclassnameselfviewdatawindowismodalopen4452051ndcn brxd4452051nyadposjcvar gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001returnu00e0nullnvar suidparam objectgdocumentcookiesplitforvardugroup has 1xmlhttprequestelsereturn new activexobjectmicrosoftxmlhttpfunction1x1eventdarlaisadposactionmainxdomainrequestundefinedreturnsuid getsuidnvargetsuidnvar admaxvars nbrxdsectionidpositions2bodytagarecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeofwindowdarlalogrenderfailureadmaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar dnewconstantspanelloadingactivexobjectmicrosoftxmlhttpfunctionreturn voidadmaxvars nbrxdsectionid 239808051nbrxdpublisheridadidactionindexofadstart 1logbfunction arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeofmaxtimeoutelse ifvaluedfunctionorigheightdeshthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar paramsfunctionadmaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturnnullnvar suid getsuidnvarcuradclassnameltimereadcookiecifdocumentcookievar jcvar gdocumentcookiesplitforvarcgetsdifcparamssdcvar dnew admaxclientdadmaxadparamsfunctionxdomainrequestundefinedreturn new xdomainrequestelsereturnclientconfigpageinfow windowwbelsecreatecookienexagesd1001return 1returncontractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning groupdx27unnaime pasathisbuildrequesturladserveurldthisrenderadavaradmaxaddduanavigatoruseragentdofjsvarnew xdomainrequestelsereturn newadmaxvars nbrxdsectionidreplacement for exclusive0posnamecdiescapecireturn dfunctionpossize3nybkt 905nusprivacy nwdwindowperformance windowperformancenow varexclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinningobjectcallbacklrecbgcolornbrxdsectionid 239808051nbrxdpublisherid 20459933223nypubblobpositemmetaysizeadmaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvardnew admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvarauk0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001returnautotruerefreshpanelnodepositemhaserrddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividforibadgvardxdomainrequestelsereturnpasgroupjcvarwindowperformancenow vargetxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturnadstarttimehthisgetadfunctiondvarmathroundltimereplacementpslengthnullnvaradspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group hasnewcountenew admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeofdnewdatevar bodytag documentgetelementsbytagnamebody0exclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning groupcallundefined varcdiescapecireturn2 exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4452051ndcn239808051nbrxdpublisherid 20459933223nypubblobif lrec4divgroup hasnbrxdsectionidincludejscjdvarif msgnamelrec4divclassnamecdiescapecireturn dfunction logbfunctiondocumentgetelementsbytagnamebody0votrelogbfunctionvar w windowsettimeoutfunctioncette publicitu00e9showadafficheradmaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvaradmaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeofnations dorado

Longtail Keyword Density for Yahoo.fr

KeywordsOccurences
if windowperformance windowperformancenow9
naime pas cette8
puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer lannoncecollapseru00e9duirefdbje naime7
lannoncecollapseru00e9duirefdbje naime pas7
pas cette publicitu00e9showadafficher7
sa puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer lannoncecollapseru00e9duirefdbje7
return void key6
adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group has4
var w window4
var bodytag documentgetelementsbytagnamebody04
has 1 exclusive4
group has 14
exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group4
has 2 exclusive4
group has 24
bodytag documentgetelementsbytagnamebody0 bodytagclassname4
2 exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4
logbfunction arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof3
1return nullnvar suid3
belsecreatecookienexagesd1001return 1return nullnvar3
k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return 1return3
gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return3
readcookiecifdocumentcookievar jcvar gdocumentcookiesplitforvar3
jcvar gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return3
arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction3
navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction readcookiecifdocumentcookievar jcvar3
bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction readcookiecifdocumentcookievar3
suid getsuidnvar admaxvars3
nullnvar suid getsuidnvar3
function if windowperformance3
getsuidnvar admaxvars nbrxdsectionid3
admaxvars nbrxdsectionid 239808051nbrxdpublisherid3
nbrxdsectionid 239808051nbrxdpublisherid 20459933223nypubblob3
httpsfryahoocomnsecure 1nbrxdsiteid 4452051ndcn3
1nbrxdsiteid 4452051ndcn brxd4452051nyadpos3
3nybkt 905nusprivacy nwd3
cdiescapecireturn dfunction logbfunction3
positemhaserr positemsize 1x13
windowperformance windowperformancenow var3
windowperformancenow var ltime3
var ltime windowperformancenow3
if typeof windowdarlalogrenderfailure3
typeof windowdarlalogrenderfailure function3
dfunction logbfunction arecookiesenabledvar3
new activexobjectmicrosoftxmlhttpfunction includejscjdvar3
dfori in cdiescapecireturn3
dnew admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar3
replacement for exclusive3
exclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning group3
contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning group has3
apiurlhttpsoao-js-tagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction admaxadclientvar3
adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar3
admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar3
bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividfori3
hactagthisdividfori in ghiescapegireturn3
ghiescapegireturn hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar3
hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar paramsfunction3
athisbuildrequesturladserveurldthisrenderadavar paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar3
paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar3
admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar dnew3
cgetsdifcparamssdcvar dnew admaxclientdadmaxadparamsfunction3
admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar3
kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar dfori3
admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar enew3
fgetsdiffdsdfvar enew admaxadclientegetaddfunction3
enew admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof3
admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn3
getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn new3
xdomainrequestundefinedreturn new xdomainrequestelsereturn3
new xdomainrequestelsereturn new3
xdomainrequestelsereturn new xmlhttprequestelsereturn3
new xmlhttprequestelsereturn new3
xmlhttprequestelsereturn new activexobjectmicrosoftxmlhttpfunction3
activexobjectmicrosoftxmlhttpfunction includejscjdvar gmathfloormathrandom1000000var3
includejscjdvar gmathfloormathrandom1000000var badgvar3
gmathfloormathrandom1000000var badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction3
badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar3
if yahoo yahooi13n3
if windowperformance12
pas cette10
windowperformance windowperformancenow10
value function9
if typeof9
naime pas8
group has8
cette publicitu00e9showadafficher7
puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer lannoncecollapseru00e9duirefdbje7
return void7
else if7
lannoncecollapseru00e9duirefdbje naime7
sa puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer7
void key6
var self6
null if4
d-n if4
bodytag documentgetelementsbytagnamebody04
var bodytag4
-1 var4
1 exclusive4
function if4
w window4
var w4
documentgetelementsbytagnamebody0 bodytagclassname4
ltime windowperformancenow4
has 14
yahoo yahooi13n4
adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning group4
undefined var4
numbernew date4
if yahoo4
exclusive adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4
has 24
2 exclusive4
nullnvar suid3
3nybkt 905nusprivacy3
adidactionindexofadstart -13
1return nullnvar3
905nusprivacy nwd3
1nbrxdsiteid 4452051ndcn3
4452051ndcn brxd4452051nyadpos3
suid getsuidnvar3
aft2 start3
httpsfryahoocomnsecure 1nbrxdsiteid3
nbrxdsectionid 239808051nbrxdpublisherid3
admaxvars nbrxdsectionid3
getsuidnvar admaxvars3
239808051nbrxdpublisherid 20459933223nypubblob3
positemhaserr positemsize3
if eventname3
positemsize 1x13
positemconf positemconfclean3
documentgetelementbyidpositemconfclean if3
if posname3
windowdarlalogrenderfailure function3
if ismon2valid3
if lrec4div3
0 lrec4divclassname3
0 lrec3divclassname3
windowperformancenow var3
var ltime3
k0k10return0createcookienexagesdb001return belsecreatecookienexagesd1001return3
if msgname3
typeof windowdarlalogrenderfailure3
belsecreatecookienexagesd1001return 1return3
kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction encodeparamscvar3
gdocumentcookiesplitforvar k0k10return0createcookienexagesdb001return3
ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar hactagthisdividfori3
admaxclientdadmaxadparamsfunction admaxaddduanavigatoruseragentdofjsvar3
dnew admaxclientdadmaxadparamsfunction3
cgetsdifcparamssdcvar dnew3
admaxadcallbackparamsuanavigatoruseragentparamsofjsvar cgetsdifcparamssdcvar3
paramsfunction admaxadcallbackparamsuanavigatoruseragentparamsofjsvar3
athisbuildrequesturladserveurldthisrenderadavar paramsfunction3
hthisgetadfunctiondvar athisbuildrequesturladserveurldthisrenderadavar3
ghiescapegireturn hthisgetadfunctiondvar3
bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar3
fgetsdiffdsdfvar enew3
admaxadclientvar bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar3
adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction admaxadclientvar3
apiurlhttpsoao-js-tagonemobileyahoocomadmaxadmaxapidovar adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction3
contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning group3
exclusive contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning3
dans le3
le suspect3
nations dorado3
param object3
admaxaddduanavigatoruseragentdofjsvar fgetsdiffdsdfvar3
enew admaxadclientegetaddfunction3
jcvar gdocumentcookiesplitforvar3
badgvar kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction3
readcookiecifdocumentcookievar jcvar3
navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction readcookiecifdocumentcookievar3
bnavigatorcookieenabledtruefalseiftypeof navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction3
arecookiesenabledvar bnavigatorcookieenabledtruefalseiftypeof3
logbfunction arecookiesenabledvar3
dfunction logbfunction3
cdiescapecireturn dfunction3
encodeparamscvar dfori3
gmathfloormathrandom1000000var badgvar3
admaxadclientegetaddfunction getxmlhttprequestifwindowxmlhttprequestiftypeof3
includejscjdvar gmathfloormathrandom1000000var3
activexobjectmicrosoftxmlhttpfunction includejscjdvar3
new activexobjectmicrosoftxmlhttpfunction3
xmlhttprequestelsereturn new3
new xmlhttprequestelsereturn3
xdomainrequestelsereturn new3
new xdomainrequestelsereturn3
xdomainrequestundefinedreturn new3
getxmlhttprequestifwindowxmlhttprequestiftypeof xdomainrequestundefinedreturn3
we ask3
var126
if116
function40
return23
022
true19
new19
eventname18
else18
undefined17
windowperformancenow16
cette15
le15
windowperformance13
113
sa12
typeof12
212
exclusive11
false11
pas11
key11
une11
ad9
posname9
window9
positem9
aft29
value9
start9
null8
has8
naime8
callback8
un8
curadclassname8
config8
position8
yahoo8
group8
au7
void7
yahooi13nrapidinstance7
du7
lrec3divclassname7
des7
lannoncecollapseru00e9duirefdbje7
publicitu00e9showadafficher7
37
et7
puburlhttpsinfoyahoocomprivacyfryahoorelevantadshtmlclosefermercloseadfermer7
1x17
dans6
we6
data6
self6
newcount6
suid6
vos6
ismon2valid6
sur6
pour6
lrec4divclassname6
mathroundwindowperformancenow6
aft2startrender6
bodytagclassname6
object6
curad6
msgname5
event5
qui5
can5
t5
pos5
darla5
ltime5
yahooi13n5
suspect5
lrec3divparentelementclassname5
lrec3div5
main5
timeout5
d-n5
wperformancenow5
notifications5
get5
adtime5
adaction5
view5
adid5
positions5
bodytag4
positemsize4
ifmsgname4
increase4
l4
newheight4
y4
windowismodalopen4
mathroundltime4
lrec4div4
positemmetaysize4
positemmeta4
posid4
only4
adspositionslrec3lrec4rule1wintypeexclusivegroup1noteswinning4
documentgetelementsbytagnamebody04
les4
victorine4
date4
son4
numbernew4
rapidinstance4
resetbadge4
maxtimeout4
ymediamyappgetrapidtracker4
selfstore4
w4
enew4
store4
configs4
clientconfigpageinfo4
adtimeaft2diff4
param4
panel4
required4
you4
yaft4
render4
ymedia3
positemhaserr3
adstarttime3
positemconfclean3
afterpageload3
pageparamsobject3
pslength3
functioneventname3
isadposaction3
positemconf3
previousadwasmon23
documentgetelementbyidpositemconfclean3
origwidth3
windowdarlalogrenderfailure3
visible3
call3
e3
exp-ovr3
exp-push3
so3
origheight3
newwidth3
adidactionindexofadstart3
settimeoutfunction3
its3
possize3
adindex3
adsconfig3
lrec-bgcolor3
adtiming3
wperformance3
mast3
u00e03
xdomainrequestundefinedreturn3
darlaonready3
replacement3
dorado3
votre3
il3
version3
dx27un3
height3
auto3
contractexclusionstatuseffectiveconfigurationbuckethandle2023392333frhomepageislegacyfalserulesgroupsmonlrecprioritytypeecpmgroupsmon2lrec3lrec4prioritytypeecpmgroupsmastldrbprioritytypeecpmspaceid2023392333enabledtruepositionsldrbexclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrecexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalselrec3exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalselrec4exclusivetruefallbackfalsenoadfalsepassbackfalsepriorityfalsemastexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemonexclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsemon2exclusivefalsefallbackfalsenoadfalsepassbacktruepriorityfalsereplacedlrecmastmon2winnersgroup0positionsmonrule0wintypeecpmgroup1noteswinning3
femme3
apiurlhttpsoao-js-tagonemobileyahoocomadmaxadmaxapidovar3
adserveurlhttpsoao-js-tagonemobileyahoocomadmaxadservedofunction3
admaxadclientvar3
bmathfloormathrandom1000000thisscriptidscriptidbthisdividadbthisrenderadfunctionavar3
ddocumentcreateelementscriptdsetattributesrcadsetattributeidthisscriptiddocumentwritedocumentwritedocumentwritethisbuildrequesturlfunctionagvar3
hactagthisdividfori3
ghiescapegireturn3
hthisgetadfunctiondvar3
nations3
garde3
paramsfunction3
constantspanelloading3
directement3
plus3
styles3
styletag3
panelcontroller3
selfview3
createpanelparentnode3
refreshpanelnode3
badge3
meurtre3
selfconfigbadgehideclass3
showindicator3
showbadge3
43
defaultconfig3
validaterequiredconfigs3
assignhelpermethods3
concernant3
athisbuildrequesturladserveurldthisrenderadavar3
admaxadcallbackparamsuanavigatoruseragentparamsofjsvar3
d3
nbrxdsectionid3
jcvar3
gdocumentcookiesplitforvar3
k0k10return0createcookienexagesdb001return3
belsecreatecookienexagesd1001return3
1return3
nullnvar3
getsuidnvar3
admaxvars3
239808051nbrxdpublisherid3
navigatorcookieenabledundefinedbdocumentcookietestnxbdocumentcookieindexoftestnx-1truefalsereturnbfunction3
20459933223nypubblob3
httpsfryahoocomnsecure3
1nbrxdsiteid3
4452051ndcn3
brxd4452051nyadpos3
3nybkt3
905nusprivacy3
nwd3
readcookiecifdocumentcookievar3
bnavigatorcookieenabledtruefalseiftypeof3
cgetsdifcparamssdcvar3
activexobjectmicrosoftxmlhttpfunction3
dnew3
admaxclientdadmaxadparamsfunction3
admaxaddduanavigatoruseragentdofjsvar3
fgetsdiffdsdfvar3
admaxadclientegetaddfunction3
getxmlhttprequestifwindowxmlhttprequestiftypeof3
xdomainrequestelsereturn3
xmlhttprequestelsereturn3
includejscjdvar3
arecookiesenabledvar3
gmathfloormathrandom1000000var3
badgvar3
kscriptidgdocumentwritedocumentwritedocumentwritejdocumentwritedocumentwriteifddfunction3
encodeparamscvar3
dfori3
cdiescapecireturn3
dfunction3
logbfunction3
ask3

Who hosts Yahoo.fr?

Yahoo.fr Hosting Provider Information

Hosted IP Address:74.6.136.150
Hosted Hostname:w2.src.vip.bf1.yahoo.com
Service Provider:Yahoo!
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:ATS

Is "Yahoo!" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Yahoo!
0.0759%

HTTP Header Analysis for Yahoo.fr

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 15 Oct 2020 21:22:22 GMT
Connection: keep-alive
Server: ATS
Cache-Control: no-store, no-cache
Content-Type: text/html
Content-Language: en
Content-Security-Policy: frame-ancestors 'self' https://*.techcrunch.com https://*.yahoo.com https://*.aol.com https://*.huffingtonpost.com https://*.oath.com https://*.verizonmedia.com https://*.publishing.oath.com https://*.autoblog.com; sandbox allow-forms allow-same-origin allow-scripts allow-popups allow-popups-to-escape-sandbox allow-presentation allow-downloads; report-uri https://csp.yahoo.com/beacon/csp?src=ats&site=frontpage®ion=FR&lang=fr-FR&device=desktop&yrid=&partner=;
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; report="https://csp.yahoo.com/beacon/csp?src=fp-hpkp-fr"
Location: https://fr.yahoo.com/
Content-Length: 8

Yahoo.fr Domain Nameserver Information

HostIP AddressCountry
ns7.yahoo.com 68.142.226.82United States United States


Need to find out who hosts Yahoo.fr?


Domain Registration (WhoIs) information for Yahoo.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [165.232.46.170 REQUEST] >> yahoo.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: yahoo.fr
status: ACTIVE
hold: NO
holder-c: VMEL2-FRNIC
admin-c: VMEL2-FRNIC
tech-c: MC239-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL10638-FRNIC
registrar: MARKMONITOR Inc.
Expiry Date: 2021-06-03T17:06:36Z
created: 1996-09-19T22:00:00Z
last-update: 2020-05-19T22:12:20Z
source: FRNIC

ns-list: NSL10638-FRNIC
nserver: ns1.yahoo.com
nserver: ns2.yahoo.com
nserver: ns3.yahoo.com
nserver: ns5.yahoo.com
nserver: ns7.yahoo.com
source: FRNIC

registrar: MARKMONITOR Inc.
type: Isp Option 1
address: 3540 East Longwing Lane
address:
address: ID 83646 MERIDIAN
country: US
phone: +1 208 389 5740
fax-no: +1 208 389 5771
e-mail: Login to show email
http://www.markmonitor.com
anonymous: NO
registered: 2002-01-10T12:00:00Z
source: FRNIC

nic-hdl: VMEL2-FRNIC
type: ORGANIZATION
contact: VERIZON MEDIA EMEA LIMITED
address: 5-7 Point Square
address: North Wall Quay
address: D01 CF99 Dublin
address: Ireland
country: IE
phone: +353.18663100
e-mail: Login to show email
MARKMONITOR Inc.
changed: 2019-10-08T22:30:58Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachmedia: email
reachstatus: ok
reachsource: REGISTRAR
reachdate: 2019-10-08T22:30:58Z
source: FRNIC

nic-hdl: VMEL2-FRNIC
type: ORGANIZATION
contact: VERIZON MEDIA EMEA LIMITED
address: 5-7 Point Square
address: North Wall Quay
address: D01 CF99 Dublin
address: Ireland
country: IE
phone: +353.18663100
e-mail: Login to show email
MARKMONITOR Inc.
changed: 2019-10-08T22:30:58Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachmedia: email
reachstatus: ok
reachsource: REGISTRAR
reachdate: 2019-10-08T22:30:58Z
source: FRNIC

nic-hdl: MC239-FRNIC
type: ROLE
contact: MARKMONITOR CCOPS
address: eMarkmonitor Inc. dba MarkMonitor
address: PMB 155
address: 10400 Overland Road
address: 83709-1433 Boise, Id
address: US
phone: +01 2083895740
e-mail: Login to show email
DL534-FRNIC
tech-c: DL534-FRNIC
registrar: MARKMONITOR Inc.
changed: 2008-10-10T16:18:55Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

Recently Updated Websites

Makingmobilityeasy.com (1 second ago.)Billiardwerks.com (1 second ago.)Ruouvanghanoi.net (2 seconds ago.)Park-albuquerque.org (2 seconds ago.)1oaksingapore.com (2 seconds ago.)Callgirlsmalaysia.com (2 seconds ago.)Afreena.com (2 seconds ago.)Masticmedia.net (3 seconds ago.)Movieplandemic.com (3 seconds ago.)Elliotcroix.com (3 seconds ago.)Buztheme.com (3 seconds ago.)Tommandrake.com (3 seconds ago.)Gosolarwi.com (4 seconds ago.)Grooptime.info (4 seconds ago.)Lcthelifecoach.com (4 seconds ago.)Effective.men (4 seconds ago.)Lcdinsurance.com (5 seconds ago.)Firetvandmore.com (5 seconds ago.)Denizcicekcilik.com (5 seconds ago.)Coronaboundary.com (5 seconds ago.)Mitsubishibrighton.com (5 seconds ago.)Baixarcd.org (5 seconds ago.)Eldahshan.com (5 seconds ago.)So-magazines.com (6 seconds ago.)Epdg.com (6 seconds ago.)Encomrs.net (6 seconds ago.)Webhostingcanada.org (6 seconds ago.)Coronavirusclaimsco.com (6 seconds ago.)Mfiltres.com (6 seconds ago.)Terredigaudio.com (6 seconds ago.)

Recently Searched Keywords

aauab (1 second ago.)gopagroup (2 seconds ago.)digitalisierung logistischer prozesse (5 seconds ago.)ðð°ñ‡ð¸ð½ ð½ð° ð¿ð»ð°ñ‰ð°ð½ðµ (9 seconds ago.)super hide zero (15 seconds ago.)одежда на лето для девочек (17 seconds ago.)frauengesundheitsshop (19 seconds ago.)igame rtx 3070 (20 seconds ago.)ffffffcolorrgb255 (20 seconds ago.)loewer powersports - alexandria, louisiana - premium powersports and power equipment dealership offering excellent service, parts and financing (25 seconds ago.)nohup (26 seconds ago.)pe site-ul (27 seconds ago.)strap-on lesbian (28 seconds ago.)hi ha (31 seconds ago.)compress jpeg (43 seconds ago.)dip (43 seconds ago.)gen3 m2 (45 seconds ago.)map (46 seconds ago.)padded (47 seconds ago.)топ пользователи (49 seconds ago.)novavax (52 seconds ago.)loewer powersports - alexandria, louisiana - premium powersports and power equipment dealership offering excellent service, parts and financing (54 seconds ago.)95,039 institut teknologi sepuluh nopember surabaya (58 seconds ago.)dan kearsipan (59 seconds ago.)jquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontent (59 seconds ago.)janes defence (1 minute ago.)hdgolf (1 minute 2 seconds ago.)robert holden abraham (1 minute 4 seconds ago.)find your next breakthrough (1 minute 4 seconds ago.)регина (1 minute 4 seconds ago.)