|  Resimli Yemek Tarifleri (Tüm Yemek Tarifleri) | En Kaliteli Yemek Tar
High trust score  | 
Kolay ve Pratik Resimli Yemek Tarifleri, Türk Mutfağından Değişik ve Pratik Lezzetler. Denenmiş, Güvenilir ve Adım Adım Resimli Yemek Tarifleri. Göbeğim, Ye-mek Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:3,735
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:27%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: IHS TELEKOM, INC.
Registration Date:2008-02-26  1 decade 10 months 2 weeks ago
Last Modified:2015-03-23  3 years 9 months 3 weeks ago
Expiration Date:2021-02-26  2 years 1 month 4 days from now

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: YE-MEK.NET
Registry Domain ID: 1410464734_DOMAIN_NET-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2015-03-23T19:20:56Z
Creation Date: 2008-02-26T21:29:54Z
Registry Expiry Date: 2021-02-26T21:29:54Z
Registrar: IHS Telekom, Inc.
Registrar IANA ID: 1091
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok
Name Server: NS1.YE-MEK.NET
Name Server: NS2.YE-MEK.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-10-04T17:02:38Z

Who hosts is hosted by IHS Telekomunikasyon Ltd in Istanbul, Istanbul, Turkey, 34720. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:IHS Telekomunikasyon Ltd
Hosted Country:TurkeyTR
Location Latitude:41.0138
Location Longitude:28.9497
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Thu, 18 Jun 2015 00:01:11 GMT
Content-Length: 19597

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-1501796973305364
Google Analytics:Not Applicable

Keyword Cloud for

yemeket yemeklerisalatayemek tariflerilepilavtariflermeze tarifleriresimlitarifisayfasmen252lerignnsebze yemeklerimenshttpspalamutpeynirlikektavada yaplanve meze tariflerizayflamaramazanpilav tarifleriusulsyaplan tarifleranaiffrndaftartariflerikebab214zelturusuetyemekleri tavadamezerss feedpoaatatl tariflerikurabiyemakarnasebzeidle yaplanevyemeklerifeedyemekleri tavada yaplantavadatavukluresimli yemekfunctionsalata vetatl231inramazan ftarpatatesvarkurabiye tarifleritruesahuryemekleri frndasalata ve mezeresimli yemek tarifleriyaplan0fyourtle yaplan tarifleryemeklerrsskftesi214zel sayfasvetavukle tariflerve mezetavuk yemekleri

Longtail Keyword Density for

ve meze tarifleri7
salata ve meze7
le yaplan tarifler4
resimli yemek tarifleri3
yemekleri tavada yaplan3
yemek tarifleri13
meze tarifleri9
le tarifler9
tatl tarifleri7
salata ve7
ve meze7
sebze yemekleri5
yaplan tarifler5
le yaplan5
pilav tarifleri4
et yemekleri4
tavuk yemekleri4
kurabiye tarifleri4
resimli yemek3
214zel sayfas3
yemekleri frnda3
ramazan ftar3
yemekleri tavada3
tavada yaplan3
rss feed3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Turkey Turkey DNS Record Analysis DNS Lookup

Serial: 1369212599
Refresh: 10800
Retry: 3600
Expire: 604800
ye-mek.netMX86400Priority: 10

Alexa Traffic Rank for

Alexa Search Engine Traffic for