Ye-mek.net Website Analysis Summary

Ye-mek.net  |  Kolay ve Pratik Resimli Yemek Tarifleri, Türk Mutfa??ndan De?i?ik ve Pratik Lezzetler. Denenmi?, Güvenilir ve Ad?m Ad?m Resimli Yemek Tarifleri. Göbe?im, Ye-mek
Low trust score  | 
Yemek Tarifleri | Resimli ve Videolu Tarifler


Rank
133,919
Rating
F
Trust Score
Low Trust Score
Estimated worth
$93,600
Estimated daily income
$156
Estimated monthly income
$4,745
Backlinks
0

Ye-mek.net has a Low Trust Score, and a Statvoo Rank of F.

Ye-mek.net is hosted by IHS Telekomunikasyon Ltd in Istanbul, Istanbul, Turkey, 34720.
Ye-mek.net has an IP Address of 94.138.206.83 and a hostname of 94.138.206.83.

The domain ye-mek.net was registered 1 decade 1 year 11 months ago by IHS TELEKOM, INC., it was last modified 4 years 10 months 3 weeks ago and currently is set to expire 1 year 10 hours 34 minutes from now.

It is the world's 133,919 most popular site among over 300 million websites.

Ye-mek.net has a total of 0 backlinks.

Ye-mek.net gets approximately 12,485 unique visitors a day and 62,425 pageviews per day.

Ye-mek.net has an estimated worth of $93,600.
An average daily income of approximately $156, which is wroughly $4,745 per month.

Whois information for ye-mek.net

Full Whois Lookup for Ye-mek.net Whois Lookup

Domain Name: YE-MEK.NET
Registry Domain ID: 1410464734_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.ihs.com.tr
Registrar URL: http://www.ihs.com.tr
Updated Date: 2015-03-23T19:20:56Z
Creation Date: 2008-02-26T21:29:54Z
Registry Expiry Date: 2021-02-26T21:29:54Z
Registrar: IHS Telekom, Inc.
Registrar IANA ID: 1091
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.YE-MEK.NET
Name Server: NS2.YE-MEK.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-04T17:02:38Z

Who hosts Ye-mek.net?

Ye-mek.net Web Server Information

Hosted IP Address:94.138.206.83
Hosted Hostname:94.138.206.83
Service Provider:IHS Telekomunikasyon Ltd
Hosted Country:TurkeyTR
Location Latitude:41.0138
Location Longitude:28.9497
Webserver Software:Not Applicable

HTTP Header Analysis for Ye-mek.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Thu, 18 Jun 2015 00:01:11 GMT
Content-Length: 19597

Need to find out who hosts Ye-mek.net?

Ye-mek.net Free SEO Report

Website Inpage Analysis for Ye-mek.net

H1 Headings:1
Yemek Tarifleri
H2 Headings:1
Yemek Tarifleri - Resimli ve Videolu Tarifler
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:30
Google Adsense:pub-1501796973305364
Google Analytics:Not Applicable

Keyword Cloud for Ye-mek.net

idpilav tariflerive mezefmeze tarifleriyaplan tariflersalata vele tariflerramazan ftarletavada yaplan214zelpeynirliyemeklerimenstarifleri231intatltatl tarifleri0patatesftarhttpsmezele yaplansalatakekevyemekkurabiye tariflerisebzetarifiyemekleri frndatavukyaplanveyemek tarifleriramazanfeedyourtpilavgnnanatruefrndaresimli yemekle yaplan tariflerrss feedsebze yemeklerisayfaskftesimakarnatavadaetyemekleri tavada yaplanyemeklerkebabturususpalamutzayflamaresimli yemek tarifleritavuk yemekleriiffunctionvartariflersalata ve mezepoaatavuklumen252leriusulkurabiye214zel sayfasve meze tariflerirsset yemeklerisahuryemekleri tavadaresimli

Longtail Keyword Density for Ye-mek.net

KeywordsOccurences
ve meze tarifleri7
salata ve meze7
le yaplan tarifler4
resimli yemek tarifleri3
yemekleri tavada yaplan3
yemek tarifleri13
meze tarifleri9
le tarifler9
tatl tarifleri7
salata ve7
ve meze7
sebze yemekleri5
yaplan tarifler5
le yaplan5
pilav tarifleri4
et yemekleri4
tavuk yemekleri4
kurabiye tarifleri4
resimli yemek3
214zel sayfas3
yemekleri frnda3
ramazan ftar3
yemekleri tavada3
tavada yaplan3
rss feed3
tarifleri90
tarifler26
yemekleri23
le17
yemek17
ve13
var12
salata9
meze9
ramazan9
yaplan9
tatl8
ftar8
kurabiye7
true6
sahur6
sebze5
makarna5
function5
214zel5
ev5
https5
peynirli5
pilav4
tavada4
kebab4
tavuk4
poaa4
frnda4
et4
ana4
yemekler4
s4
04
men252leri4
kek4
231in4
usul4
tarifi4
rss3
feed3
yourt3
kftesi3
turusu3
tavuklu3
zayflama3
patates3
id3
if3
resimli3
gnn3
mens3
palamut3
sayfas3
f3

What are the nameservers for ye-mek.net?

Ye-mek.net Domain Nameserver Information

HostIP AddressCountry
ns1.ye-mek.net 94.138.206.82Turkey Turkey
ns2.ye-mek.net 94.138.206.82Turkey Turkey