يلوبيدجز - الموقع الرسمي يلوبيدجز مصر / دليل الأعمال - محرك البحث المحلي

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 71,643
Estimated Worth: $257,760
Category: Reference > Directories

يلوبيدجز مصر هو دليل هواتف الأعمال التجارية، يتضمن قوائم الأعمال المحليّة وأرقام هواتفها، وإعلاناتها التجارية. استخدم محرك بحث يلوبيدجز مصر للحصول على كل ما تريد معرفته من المعلومات المحليّة.



Domain summary

Last updated
2021-04-15
Domain label
yellowpages
Domain extension
com.eg
Global Traffic Rank
71,643
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$257,760
Estimated daily income
$358
Estimated monthly income
$10,889

Frequently Asked Questions (FAQ)

Q: When was Yellowpages.com.eg registered?
A: Yellowpages.com.eg was registered 2 months, 1 week, 2 days, 9 hours, 46 minutes, 59 seconds ago on Thursday, April 15, 2021.
Q: When was the WHOIS for Yellowpages.com.eg last updated?
A: The WHOIS entry was last updated 2 months, 1 week, 2 days, 9 hours, 46 minutes, 59 seconds ago on Thursday, April 15, 2021.
Q: What are Yellowpages.com.eg's nameservers?
A: DNS for Yellowpages.com.eg is provided by the following nameservers:
  • wesley.ns.cloudflare.com
  • donna.ns.cloudflare.com
Q: Who is the registrar for the Yellowpages.com.eg domain?
A: The domain has been registered at .
Q: What is the traffic rank for Yellowpages.com.eg?
A: Yellowpages.com.eg ranks 71,643 globally on Alexa. Yellowpages.com.eg has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Yellowpages.com.eg each day?
A: Yellowpages.com.eg receives approximately 29,795 visitors and 178,770 page impressions per day.
Q: What IP address does Yellowpages.com.eg resolve to?
A: Yellowpages.com.eg resolves to the IPv4 address 172.67.71.123.
Q: In what country are Yellowpages.com.eg servers located in?
A: Yellowpages.com.eg has servers located in the United States.
Q: What webserver software does Yellowpages.com.eg use?
A: Yellowpages.com.eg is powered by CloudFlare webserver.
Q: Who hosts Yellowpages.com.eg?
A: Yellowpages.com.eg is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Yellowpages.com.eg worth?
A: Yellowpages.com.eg has an estimated worth of $257,760. An average daily income of approximately $358, which is roughly $10,889 per month.

Yellowpages.com.eg Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yellowpages.com.eg Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yellowpages.com.eg

H1 Headings

1 :
  1. ابحث. اوصل. اتصل!

H2 Headings

5 :
  1. الأنشطة الأكثر شيوعا
  2. الكلمات الأكثر بحثا
  3. أماكن جديدة
  4. الشركات الأشهر
  5. حمّل تطبيق يلوبيدجز المجاني اليوم

H3 Headings

2 :
  1. {{companyName}}
  2. {{companyName}}

H4 Headings

3 :
  1. {{name}}عرض الكل ({{countCategory}})
  2. خدمه العملاء
  3. تابعنا على

H5 Headings

2 :
  1. {{new_opening_first.companyName}}
  2. {{companyName}}

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-1479413-1

Links - Internal

20:

Links - Internal (nofollow)

0:

Links - Outbound

20:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yellowpages.com.eg

facebookfunctioncontentenglishua14794131codecompanynametypeadeachnamegasendwhatsappvar

Longtail Keyword Density for Yellowpages.com.eg

KeywordsOccurences
var21
each8
name5
gasend4
code4
ad4
english3
content3
companyname3
whatsapp3
facebook3
ua-1479413-13
function3
type3

Who hosts Yellowpages.com.eg?

Yellowpages.com.eg Hosting Provider Information

Hosted IP Address:172.67.71.123
Hosted Hostname:172.67.71.123
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
T-Mobile USA, Inc.
1.3700%

HTTP Header Analysis for Yellowpages.com.eg

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 15 Apr 2021 21:19:05 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: infraLayer
Vary: Accept-Encoding
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Access-Control-Allow-Origin: http://eyp1.iypcdn.com; http://eyp2.iypcdn.com; http://eyp3.iypcdn.com; http://eyp4.iypcdn.com; http://logs.yp.eg; https://logs.yp.eg; https://api.overtok-qa.com
Strict-Transport-Security: max-age=63072000; includeSubdomains
CF-Cache-Status: DYNAMIC
cf-request-id: 0978fff19a0000004ef7a77000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=FmvwufGTUXFZVyNIR5eAGc23Iv5nafJEBzL0d8wk5BsBa8jYK709oK/stBwzFva8uGJOgcr5CcD6Bi2S+P8rPeQIkdcEAu43R92w0R5tXKWUWs6Q+rnZ"}],"max_age":604800,"group":"cf-nel"}
NEL: {"max_age":604800,"report_to":"cf-nel"}
Server: cloudflare
CF-RAY: 640835c8f963004e-LHR
Content-Encoding: gzip
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Yellowpages.com.eg Domain Nameserver Information

HostIP AddressCountry
wesley.ns.cloudflare.com 173.245.59.246
donna.ns.cloudflare.com 172.64.32.151


Need to find out who hosts Yellowpages.com.eg?


Domain Registration (WhoIs) information for Yellowpages.com.eg

 % This is the RIPE Database query service.
% The objects are in RPSL format.
%
% The RIPE Database is subject to Terms and Conditions.
% See http://www.ripe.net/db/support/db-terms-conditions.pdf

% Note: this output has been filtered.
% To receive output for a database update, use the "-B" flag.

%ERROR:101: no entries found
%
% No entries found in source RIPE.

% This query was served by the RIPE Database Query Service version 1.98 (HEREFORD)

Websites with Similar Names

Yello-direktvertrieb.de
Direktvertrieb von Yello Strom und Gas. Jetzt bewerben! Yello Direktvertrieb powered by pso
Yello-group.com
Yello Group| La banque en ligne pour tous | Yello-Group.com/
Yello-mello.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Yello-my.sharepoint.com
Sign in to your account
Yello-pixel.com
yello-pixel.com is coming soon

Recently Updated Websites

Blakemoresupplies.co.uk (1 second ago.)Creditominas.com (2 seconds ago.)Heartwoodpsychology.com (3 seconds ago.)Standard-design.com (4 seconds ago.)Coinlist.online (6 seconds ago.)Moinhos-velhos.com (6 seconds ago.)Vmyue.com (7 seconds ago.)Pbline.com (7 seconds ago.)Courage-sharpen.xyz (8 seconds ago.)211cnydisability.org (9 seconds ago.)Tokerunderground.com (9 seconds ago.)Shehlachatoor.com (9 seconds ago.)Accident-lawyersjpard.space (11 seconds ago.)Cloudclient.net (11 seconds ago.)Dvga.online (12 seconds ago.)Aoabet2547.com (12 seconds ago.)Scr3mm.shop (12 seconds ago.)Revelspeakers.com (12 seconds ago.)Bookvps.com (13 seconds ago.)Judo.or.jp (13 seconds ago.)Womenshairstyle.com (14 seconds ago.)Myoakhurst.com (15 seconds ago.)Dobbsrealestate.com (16 seconds ago.)Toowoomba.org (16 seconds ago.)Utahseopros.com (17 seconds ago.)Textfsmhelper.com (18 seconds ago.)Bonchablog.com (18 seconds ago.)Danielebatteta.com (19 seconds ago.)Scarletmoonsilverworks.com (19 seconds ago.)Teamgsi.com (19 seconds ago.)

Recently Searched Keywords

相模增大膏一盒能用多久 相模膏的使用方法 (1 second ago.)cccccc (2 seconds ago.)загадочный «манул» (3 seconds ago.)height 100 width (3 seconds ago.)call email (4 seconds ago.)wrap-reverse (5 seconds ago.)color-stop1 113d67 (6 seconds ago.)خودکشی شورای شهر خرم آباد (7 seconds ago.)functionevent data datadataforeachfunctionevdata (9 seconds ago.)동방신기 팬픽 윤재 (9 seconds ago.)double end bag review (10 seconds ago.)助理建筑师 (11 seconds ago.)rustington (12 seconds ago.)editora vozes (13 seconds ago.)about fgm (17 seconds ago.)mediterranean (18 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (22 seconds ago.)current page: prints for sale (22 seconds ago.)dirltr 2bjtr (24 seconds ago.)marian (29 seconds ago.)tabor hill discord (29 seconds ago.)vpk name news (31 seconds ago.)belted (39 seconds ago.)ja ich (42 seconds ago.)explainers (44 seconds ago.)vikings cast (45 seconds ago.)vw t6 california beach 2.0 tdi: gebraucht (46 seconds ago.)poziom obsugi (46 seconds ago.)2.57m in feet (47 seconds ago.)focus28466 d1fbt (47 seconds ago.)