Yelp.be  |  Bruxelles Restaurants, dentistes, bars, salons de beauté, médecins
Low trust score  | 
Bruxelles Avis et recommandations des utilisateurs sur les meilleurs restaurants, magasins, lieux de vie nocturne, loisirs, services, etc. sur Yelp.




Yelp.be Website Information

Website Ranks & Scores for Yelp.be

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:61,461
Majestic Rank Majestic Rank:181,713
Domain Authority Domain Authority:46%
DMOZ DMOZ Listing:No

Domain Information for Yelp.be

Domain Registrar: DNS Belgium

Whois information for yelp.be

Full Whois Lookup for Yelp.be Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Yelp.be. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: yelp.be
Status: NOT AVAILABLE
Registered: Fri Feb 25 2005

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:

Registrar:
Name: MarkMonitor Inc.
Website: http://www.markmonitor.com

Nameservers:
ns02.midtowndoornailns.com
dns3.p05.nsone.net
dns4.p05.nsone.net
ns04.midtowndoornailns.com
ns03.midtowndoornailns.com
ns01.midtowndoornailns.com
dns2.p05.nsone.net
dns1.p05.nsone.net

Keys:

Flags:
clientTransferProhibited

Please visit www.dnsbelgium.be for more info.

Who hosts Yelp.be?

Yelp.be is hosted by Yelp! Inc. in California, San Francisco, United States, 94103.
Yelp.be has an IP Address of 199.255.190.28 and a hostname of megavip-www.iad1.yelp.com.



Yelp.be Web Server Information

Hosted IP Address:199.255.190.28
Hosted Hostname:megavip-www.iad1.yelp.com
Service Provider:Yelp! Inc.
Hosted Country:United StatesUS
Location Latitude:37.776
Location Longitude:-122.413
Webserver Software:Not Applicable

HTTP Header Analysis for Yelp.be

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 23 Jun 2015 06:10:02 GMT
Server: Apache
X-Node: web77-r7-iad1, www_all
Cache-Control: private
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
X-Mode: ro
X-Proxied: extlb1-r1-iad1


Need to find out who hosts Yelp.be?

Yelp.be Free SEO Report

Website Inpage Analysis for Yelp.be

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yelp.be

svgviecanadaenabled falsefunctionvarenglishmalaysiafalseampservicesespaoletpasseryelpfranaisdeutschfallbackplusenabledpropostrue

Longtail Keyword Density for Yelp.be

KeywordsOccurences
enabled false3
english12
yelp10
amp8
var7
et5
services5
false5
function4
espaol4
franais4
malaysia3
canada3
propos3
deutsch3
plus3
fallback3
passer3
vie3
enabled3
svg3
true3

What are the nameservers for yelp.be?

Yelp.be Domain Nameserver Information

HostIP AddressCountry
ns2.p18.dynect.net 204.13.250.18United States United States
ns1.p18.dynect.net 208.78.70.18United States United States
ns4.p18.dynect.net 204.13.251.18United States United States
ns3.p18.dynect.net 208.78.71.18United States United States

Yelp.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yelp.be is a scam?