Yelp.ca  |  Toronto Restaurants, Dentists, Bars, Beauty Salons, Doctors
High trust score  | 
Toronto User Reviews and Recommendations of Top Restaurants, Shopping, Nightlife, Entertainment, Services and More at Yelp

Yelp.ca Website Information

Yelp.ca has a High trust score, a Statvoo Rank of B, an Alexa Rank of 8,770, a Majestic Rank of 4,932, a Domain Authority of 78% and is not listed in DMOZ.

Yelp.ca is hosted by Yelp! Inc. in California, San Francisco, United States, 94105.
Yelp.ca has an IP Address of 198.51.132.28 and a hostname of megavip-www.sfo2.yelp.com.

The domain yelp.ca was registered 1 decade 3 years 1 month ago by , it was last modified 4 years 5 months 1 week ago and currently is set to expire 3 years 2 months 11 hours ago.


Whois information for yelp.ca

Full Whois Lookup for Yelp.ca Whois Lookup

Domain name: yelp.ca
Domain status: registered
Creation date: 2006/07/17
Expiry date: 2018/07/17
Updated date: 2016/09/07
DNSSEC: Unsigned

Registrar:
Name: MarkMonitor International Canada Ltd.
Number: 5000040

Registrant:
Name: Yelp Inc. TMA 858370

Administrative contact:
Name: Laurence Wilson
Postal address: 140 New Montgomery
9th Floor
San Francisco CA 60504 United States
Phone: +1.4159083801
Fax:
Email: Login to show email
contact:
Name: Laurence Wilson
Postal address: 140 New Montgomery
9th Floor
San Francisco CA 60504 United States
Phone: +1.4159083801
Fax:
Email: Login to show email
servers:
dns1.p03.nsone.net
dns2.p03.nsone.net
dns3.p03.nsone.net
ns03.midtowndoornailns.com
ns04.midtowndoornailns.com
ns02.midtowndoornailns.com
dns4.p03.nsone.net
ns01.midtowndoornailns.com

% WHOIS look-up made at 2017-08-16 03:14:04 (GMT)
%
% Use of CIRA's WHOIS service is governed by the Terms of Use in its Legal
% Notice, available at http://www.cira.ca/legal-notice/?lang=en
%
% (c) 2017 Canadian Internet Registration Authority, (http://www.cira.ca/)

Who hosts Yelp.ca?

Yelp.ca Web Server Information

Hosted IP Address:198.51.132.28
Hosted Hostname:megavip-www.sfo2.yelp.com
Service Provider:Yelp! Inc.
Hosted Country:United StatesUS
Location Latitude:37.7885
Location Longitude:-122.395
Webserver Software:Not Applicable

HTTP Header Analysis for Yelp.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 09 Jun 2015 14:28:55 GMT
Server: Apache
X-Node: web62-r7-sfo2, www_all
Cache-Control: private
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
X-Mode: ro
X-Proxied: extlb1-r4-sfo2


Need to find out who hosts Yelp.ca?

Yelp.ca Free SEO Report

Website Inpage Analysis for Yelp.ca

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yelp.ca

unitedrepublicblogsupporttruefalsesvgfranaismorevarskipactivitymalaysiaserviceshomelocaldeutschenabledyelpfallbackenglishbusinesscanadaespaolfunctionamp

Longtail Keyword Density for Yelp.ca

KeywordsOccurences
yelp12
english12
var7
services7
amp7
business5
home4
united4
true4
malaysia4
espaol4
false4
function4
local4
franais4
republic3
enabled3
canada3
support3
skip3
fallback3
more3
activity3
svg3
blog3
deutsch3

What are the nameservers for yelp.ca?

Yelp.ca Domain Nameserver Information

HostIP AddressCountry
dns1.p05.nsone.net 198.51.44.5United States United States
dns2.p05.nsone.net 198.51.45.5United States United States
dns4.p05.nsone.net 198.51.45.69United States United States
dns3.p05.nsone.net 198.51.44.69United States United States

Yelp.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yelp.ca is a scam?