Yelp.cl  |  Restaurantes, dentistas, bares, salones de belleza y médicos en Santiago
Low trust score  | 
Santiago reseñas y recomendaciones de los usuarios sobre los mejores restaurantes, tiendas, locales nocturnos, ocio, servicios y mucho más en Yelp

Yelp.cl Website Information

Yelp.cl has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 297,309, a Majestic Rank of 708,838, a Domain Authority of 40% and is not listed in DMOZ.

Yelp.cl is hosted by Yelp! Inc. in California, San Francisco, United States, 94103.
Yelp.cl has an IP Address of 199.255.190.28 and a hostname of megavip-www.iad1.yelp.com.

The domain yelp.cl was registered 201 decades 8 years 11 months ago by NIC Chile, it was last modified 201 decades 8 years 11 months ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for yelp.cl

Full Whois Lookup for Yelp.cl Whois Lookup

yelp.cl:

ACE: yelp.cl (RFC-3490, RFC-3491, RFC-3492)

Yelp Inc.

Contacto Administrativo (Administrative Contact):
Nombre : MarkMonitor Inc.
Organizacin:

Contacto Tcnico (Technical Contact):
Nombre : MarkMonitor Inc.
Organizacin:

Servidores de nombre (Domain servers):
dns3.p07.nsone.net
dns1.p07.nsone.net
dns2.p07.nsone.net
ns01.midtowndoornailns.com
ns03.midtowndoornailns.com

Fecha de expiracin (Expiration date): 2018-05-23 18:13:02 CLT

Agente Registrador (Registrar):
MarkMonitor Inc.

Ms informacin (More information):
http://www.nic.cl/registry/Whois.do?d=yelp.cl

Este mensajes est impreso en ISO-8859-1
(This message is printed in ISO-8859-1)

Who hosts Yelp.cl?

Yelp.cl Web Server Information

Hosted IP Address:199.255.190.28
Hosted Hostname:megavip-www.iad1.yelp.com
Service Provider:Yelp! Inc.
Hosted Country:United StatesUS
Location Latitude:37.776
Location Longitude:-122.413
Webserver Software:Not Applicable

HTTP Header Analysis for Yelp.cl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 17 Aug 2015 22:09:32 GMT
Server: Apache
X-Node: web1-r1-iad1, www_all
Cache-Control: private
X-XSS-Protection: 1; report=https://www.yelp.com/xss_protection_report
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
X-Mode: ro
X-Proxied: extlb1-r1-iad1


Need to find out who hosts Yelp.cl?

Yelp.cl Free SEO Report

Website Inpage Analysis for Yelp.cl

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yelp.cl

parafallbackfranaissobrevarenableddeutschsvgtruesaltarserviciosespaolyhomeyelpmalaysiavidafalsemsactividadenglishfunction

Longtail Keyword Density for Yelp.cl

KeywordsOccurences
english12
yelp10
y7
var7
servicios6
true4
function4
espaol4
false4
franais4
malaysia3
deutsch3
enabled3
sobre3
para3
saltar3
fallback3
vida3
home3
svg3
ms3
actividad3

What are the nameservers for yelp.cl?

Yelp.cl Domain Nameserver Information

HostIP AddressCountry
ns1.p18.dynect.net 208.78.70.18United States United States
ns2.p18.dynect.net 204.13.250.18United States United States
ns3.p18.dynect.net 208.78.71.18United States United States
ns4.p18.dynect.net 204.13.251.18United States United States

Yelp.cl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yelp.cl is a scam?