Yelp.dk  |  København Restauranter, tandlæger, barer, skønhedssaloner, læger
Low trust score  | 
København anmeldelser og anbefalinger af de bedste restauranter, shopping, natteliv, underholdning, serviceydelser med mere på Yelp

Yelp.dk Website Information

Yelp.dk has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 311,768, a Majestic Rank of 376,069, a Domain Authority of 45% and is not listed in DMOZ.

Yelp.dk is hosted by Yelp! Inc. in California, San Francisco, United States, 94103.
Yelp.dk has an IP Address of 199.255.190.228 and a hostname of megavip-www.iad1.yelp.com.

The domain yelp.dk was registered 201 decades 8 years 9 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for yelp.dk

Full Whois Lookup for Yelp.dk Whois Lookup

# Hello 2a01:7e00::f03c:91ff:fe84:f734. Your session has been logged.
#
# Copyright (c) 2002 - 2017 by DK Hostmaster A/S
#
# Version: 2.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: yelp.dk
DNS: yelp.dk
Registered: 2003-08-28
Expires: 2018-08-31
Registration period: 1 year
VID: no
Dnssec: Unsigned delegation
Status: Active

Nameservers
Hostname: dns1.p06.nsone.net
Hostname: dns2.p06.nsone.net
Hostname: dns3.p06.nsone.net
Hostname: dns4.p06.nsone.net
Hostname: ns01.midtowndoornailns.com
Hostname: ns03.midtowndoornailns.com
Hostname: ns04.midtowndoornailns.com

# Use option --show-handles to get handle information.
# Whois HELP for more help.

Who hosts Yelp.dk?

Yelp.dk Web Server Information

Hosted IP Address:199.255.190.228
Hosted Hostname:megavip-www.iad1.yelp.com
Service Provider:Yelp! Inc.
Hosted Country:United StatesUS
Location Latitude:37.776
Location Longitude:-122.413
Webserver Software:Not Applicable

HTTP Header Analysis for Yelp.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 31 Jul 2015 09:40:02 GMT
Server: Apache
X-Node: web74-r7-iad1, www_all
Cache-Control: private
X-XSS-Protection: 1; report=https://www.yelp.com/xss_protection_report
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
X-Mode: ro
X-Proxied: extlb1-r1-iad1


Need to find out who hosts Yelp.dk?

Yelp.dk Free SEO Report

Website Inpage Analysis for Yelp.dk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yelp.dk

yelpdeutschlokaleenglishpmalaysiadintilvitrueenabledcanadafalsefallbackaktivitetspringspring tilogespaolsvgfunctionhomefranaisserviceydelservarom

Longtail Keyword Density for Yelp.dk

KeywordsOccurences
spring til3
english12
og11
yelp10
var7
false4
lokale4
din4
malaysia4
franais4
espaol4
serviceydelser4
true4
function4
deutsch3
svg3
canada3
fallback3
home3
om3
til3
enabled3
spring3
aktivitet3
vi3
p3

What are the nameservers for yelp.dk?

Yelp.dk Domain Nameserver Information

HostIP AddressCountry
ns2.p18.dynect.net 204.13.250.18United States United States
ns3.p18.dynect.net 208.78.71.18United States United States
ns4.p18.dynect.net 204.13.251.18United States United States
ns1.p18.dynect.net 208.78.70.18United States United States

Yelp.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yelp.dk is a scam?