Yelp.fr  |  Paris Restaurants, dentistes, bars, salons de beauté, médecins
Low trust score  | 
Paris Avis et recommandations des utilisateurs sur les meilleurs restaurants, magasins, lieux de vie nocturne, loisirs, services, etc. sur Yelp.




Yelp.fr Website Information

Website Ranks & Scores for Yelp.fr

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:22,507
Majestic Rank Majestic Rank:62,455
Domain Authority Domain Authority:66%
DMOZ DMOZ Listing:No

Whois information for yelp.fr

Full Whois Lookup for Yelp.fr Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Yelp.fr. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

%%
%% This is the AFNIC Whois server.
%%
%% complete date format : DD/MM/YYYY
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [2a01:7e00:0000:0000:f03c:91ff:fe84:f734 REQUEST] >> yelp.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: yelp.fr
status: ACTIVE
hold: NO
holder-c: MIL11-FRNIC
admin-c: MIL11-FRNIC
tech-c: MI3669-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL171278-FRNIC
registrar: MARKMONITOR Inc.
Expiry Date: 24/01/2018
created: 23/06/2006
last-update: 27/09/2016
source: FRNIC

ns-list: NSL171278-FRNIC
nserver: dns1.p05.nsone.net
nserver: dns2.p05.nsone.net
nserver: dns3.p05.nsone.net
nserver: dns4.p05.nsone.net
nserver: ns01.midtowndoornailns.com
nserver: ns02.midtowndoornailns.com
nserver: ns03.midtowndoornailns.com
nserver: ns04.midtowndoornailns.com
source: FRNIC

registrar: MARKMONITOR Inc.
type: Isp Option 1
address: 3540 East Longwing Lane
address:
address: ID 83646 MERIDIAN
country: US
phone: +1 208 389 5740
fax-no: +1 208 389 5771
e-mail: Login to show email
http://www.markmonitor.com
anonymous: NO
registered: 10/01/2002
source: FRNIC

nic-hdl: MIL11-FRNIC
type: ORGANIZATION
contact: MarkMonitor International Limited
address: MarkMonitor International Limited
address: The Johnson Building
address: 77 Hatton Garden
address: EC1N 8JS London
address: EC1N 8JS
country: GB
phone: +44 2032062220
fax-no: +44 8704878977
e-mail: Login to show email
MARKMONITOR Inc.
changed: 25/08/2016 Login to show email
NO
obsoleted: NO
source: FRNIC

nic-hdl: MI3669-FRNIC
type: ORGANIZATION
contact: MarkMonitor Inc.
address: 3540 East Longwing Lane, Suite 300
address: 83646 Meridian
address: ID
country: US
phone: +1 2083895740
fax-no: +1 2083895771
e-mail: Login to show email
MARKMONITOR Inc.
changed: 28/03/2017 Login to show email
NO
obsoleted: NO
source: FRNIC

Who hosts Yelp.fr?

Yelp.fr is hosted by Yelp! Inc. in California, San Francisco, United States, 94103.
Yelp.fr has an IP Address of 199.255.190.228 and a hostname of megavip-www.iad1.yelp.com.



Yelp.fr Web Server Information

Hosted IP Address:199.255.190.228
Hosted Hostname:megavip-www.iad1.yelp.com
Service Provider:Yelp! Inc.
Hosted Country:United StatesUS
Location Latitude:37.776
Location Longitude:-122.413
Webserver Software:Not Applicable

HTTP Header Analysis for Yelp.fr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 12 Jun 2015 15:55:02 GMT
Server: Apache
X-Node: web74-r7-iad1, www_all
Cache-Control: private
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
X-Mode: ro
X-Proxied: extlb1-r2-iad1


Need to find out who hosts Yelp.fr?

Yelp.fr Free SEO Report

Website Inpage Analysis for Yelp.fr

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Yelp.fr

malaysiafallbackplusvarespaolampdeutschhomeetpasseryelpaidefalseenglishservicesfranaisenabledsvgproposviefunctionblogtruecanada

Longtail Keyword Density for Yelp.fr

KeywordsOccurences
english12
yelp11
amp8
var7
services5
et5
true4
espaol4
false4
function4
franais4
malaysia3
deutsch3
canada3
aide3
enabled3
plus3
fallback3
svg3
passer3
vie3
propos3
home3
blog3

What are the nameservers for yelp.fr?

Yelp.fr Domain Nameserver Information

HostIP AddressCountry
ns4.p18.dynect.net 204.13.251.18United States United States
ns1.p18.dynect.net 208.78.70.18United States United States
ns2.p18.dynect.net 204.13.250.18United States United States
ns3.p18.dynect.net 208.78.71.18United States United States

Yelp.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yelp.fr is a scam?