Personal Banking & Corporate Banking Services in India – YES BANK

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 14,160
Estimated Worth: $1,347,120
Category: This site has not been categorized yet

YES BANK offers personal banking, corporate banking & internet banking services including accounts, deposits, credit cards, home loan, personal loans, insurance, etc.



Domain summary

Last updated
2021-04-07
Domain label
yesbank
Domain extension
co.in
Global Traffic Rank
14,160
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$1,347,120
Estimated daily income
$1,871
Estimated monthly income
$56,910

Rank summary

How is yesbank.co.in ranked relative to other sites:

Percentage of visits to yesbank.co.in from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Yesbank.co.in registered?
A: Yesbank.co.in was registered 1 year, 2 months, 1 week, 5 days, 20 hours, 10 minutes, 43 seconds ago on Tuesday, February 4, 2020.
Q: When was the WHOIS for Yesbank.co.in last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 1 week, 5 days, 20 hours, 10 minutes, 43 seconds ago on Tuesday, February 4, 2020.
Q: What are Yesbank.co.in's nameservers?
A: DNS for Yesbank.co.in is provided by the following nameservers:
  • a12-67.akam.net
  • a11-66.akam.net
  • a1-27.akam.net
  • a13-64.akam.net
  • a18-65.akam.net
  • a24-66.akam.net
Q: Who is the registrar for the Yesbank.co.in domain?
A: The domain has been registered at .
Q: What is the traffic rank for Yesbank.co.in?
A: Yesbank.co.in ranks 14,160 globally on Alexa. Yesbank.co.in has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Yesbank.co.in each day?
A: Yesbank.co.in receives approximately 155,890 visitors and 935,340 page impressions per day.
Q: What IP address does Yesbank.co.in resolve to?
A: Yesbank.co.in resolves to the IPv4 address .
Q: In what country are Yesbank.co.in servers located in?
A: Yesbank.co.in has servers located in the .
Q: What webserver software does Yesbank.co.in use?
A: Yesbank.co.in is powered by webserver.
Q: Who hosts Yesbank.co.in?
A: Yesbank.co.in is hosted by in .
Q: How much is Yesbank.co.in worth?
A: Yesbank.co.in has an estimated worth of $1,347,120. An average daily income of approximately $1,871, which is roughly $56,910 per month.

Yesbank.co.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yesbank.co.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yesbank.co.in

H1 Headings

2 :
  1. Are you looking for?...
  2. How may we help you today?

H2 Headings

9 :
  1. Popular Searches...
  2. PERSONALBANKING
  3. CORPORATE BANKING
  4. PERSONALBANKING FOR
  5. Individual
  6. YES Premia
  7. NRI
  8. YES FIRST
  9. Yes Private

H3 Headings

9 :
  1. Enhanced Security for Credit Card Transactions
  2. Earn YES Rewardz Points on successful referral
  3. INTRODUCING ELEGANCE DEBIT CARD FOR WOMEN
  4. YES Essence
  5. #NayiUdaanKiNayiZimmedari
  6. YES MSME
  7. INTRODUCING WELLNESS CREDIT CARDS
  8. Join us in our Journey of Transformation
  9. Invest in Fixed Deposits

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

20 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

298:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yesbank.co.in

crossdomain truegovernmentajax crossdomain truemilitaryyes first yesfunctionid3debitmsmeprivatesavingsifprogrammesreturn falsefinancetruenewsalaryfixedtravelfalse vardepositspremiaselfemployedsecureconnectimportantnbspresponsedebit cardpurposeidtransactionseventsmedialoaderforalltrueaccountgstconsolelogdatalayerpushdaysbanking solutionsyesyes rewardzcardsrewardzxmlhttprequestyes gstvalue1nonepay yeswindowunbindunloadidid4getting started yessearchdataknowmorenrihomeschemesotherxcolorasyncajax crossdomainmanagementlawyercurrentcurrent accountvarstringvalue2serviceyes firstinsightsprimeknowledgesearchmainvaldatatypepayurlvarsundefinedbankcontenttypesuccessstringvalue2 ifstringindex2onlinecards wealthpersonalagriindusdeposits nrigetmobilebackgroundimagetrue false varcard yes0moneywealthbenefitsbackgroundcolorlibusinesshasclassactive trueyes onlinecredit cardfirst privilegesopenfirst yesdefencetrue consolelogin getdigital bankingsec1ilbotmlist lislice0paymentsectotalwealth managementcreditcards wealth managementtrue falseajaxvar secothersknow moreyes bankcashhome loanid2smartilbotmlistyes msmefalseoptionselectedval vargovservicesprogramservicespathwindowlocationpathnameworkinprivateoccupationmore loaderforallfalseproductsfunction windowunbindunloadgettinggovernment schemescorporatenbsp knowbanking yeselseloaderforallfalsecredit cardshealthcareresourcesyes first privilegesreturnfixed depositsclickcardpositiveoptionselectedvaldatalayerpushoccupationtrue consoleloginlibusinesshasclassactiveid1libusinesshasclassactive true falsevar idindividualcrossdomainyousolutionsfirstsavings accounturllislice0consoleloginbusinessouragriculturepathwindowlocationpathname consolelogdatalayerpushgetting starteddepositaccountwrapyes privateusprivilegesinvestmentsloansyes premiaifstringindex2valuedigitalalertinsidetypeddatakeynbsp know moreaccountsmodalconsolelogin getsportscontactreportsxmlhttpstarted yeswidthbankingfunction varloanstartedhr

Longtail Keyword Density for Yesbank.co.in

KeywordsOccurences
true false var16
true consolelogin get16
nbsp know more5
cards wealth management4
getting started yes4
yes first yes4
libusinesshasclassactive true false4
yes first privileges3
ajax crossdomain true3
true false18
consolelogin get18
true consolelogin16
false var16
yes first11
know more10
yes premia10
credit card7
stringvalue2 ifstringindex26
savings account5
nbsp know5
yes private5
current account5
var id5
yes bank5
libusinesshasclassactive true4
banking solutions4
wealth management4
cards wealth4
function windowunbindunload4
yes msme4
getting started4
banking yes4
started yes4
first yes4
fixed deposits3
more loaderforallfalse3
government schemes3
deposits nri3
pathwindowlocationpathname consolelogdatalayerpush3
home loan3
yes rewardz3
optionselectedval var3
function var3
ilbotmlist lislice03
var sec3
debit card3
return false3
first privileges3
crossdomain true3
ajax crossdomain3
yes gst3
pay yes3
yes online3
digital banking3
credit cards3
card yes3
yes70
var63
true44
function30
false26
banking26
business21
else21
get20
consolelogin18
occupation18
more16
loan16
datalayerpushoccupation15
card14
accountwrap14
nri14
url13
us12
account12
cards11
first11
premia10
if10
nbsp10
know10
credit10
solutions9
services9
bank9
gst9
ifstringindex28
stringvalue28
msme8
deposits8
lawyer8
programmes7
online7
loans7
corporate7
loaderforallfalse7
accounts7
data7
savings7
loaderforalltrue7
management7
pay6
typeddata6
value6
current6
digital6
return5
response5
id5
pathwindowlocationpathname5
other5
connect5
ajax5
privileges5
x5
ilbotmlist5
knowledge5
new5
private5
open5
xmlhttp4
military4
windowunbindunload4
optionselectedval4
hr4
libusinesshasclassactive4
none4
workinprivate4
agriindus4
sports4
others4
govservices4
id44
defence4
you4
selfemployed4
sec4
id34
id24
undefined4
xmlhttprequest4
total4
color4
getting4
money4
started4
home4
mobile4
our4
important4
resources4
service4
fixed4
wealth4
04
individual4
insights4
finance3
cash3
purposeid3
prime3
events3
type3
investments3
rewardz3
smart3
program3
schemes3
government3
deposit3
consolelogdatalayerpush3
salary3
modal3
width3
background-color3
benefits3
click3
urlvars3
id13
searchmainval3
async3
contenttype3
success3
key3
days3
searchdata3
alertinside3
value13
contact3
media3
reports3
background-image3
travel3
positive3
payment3
secure3
lislice03
transactions3
products3
agriculture3
sec13
debit3
crossdomain3
healthcare3
personal3

Who hosts Yesbank.co.in?

Yesbank.co.in Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

Is "" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
0.0061%

HTTP Header Analysis for Yesbank.co.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server:
X-Frame-Options: SAMEORIGIN
Vary: Host,Accept-Encoding
Cache-Control: no-store
Last-Modified: Wed, 07 Apr 2021 11:01:30 GMT
device_type: Touch
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Content-Language: en
Strict-Transport-Security: max-age=157680000
X-Akamai-Transformed: 9 30710 0 pmb=mTOE,1
Date: Wed, 07 Apr 2021 11:01:30 GMT
Content-Length: 27769
Connection: keep-alive

Yesbank.co.in Domain Nameserver Information

HostIP AddressCountry
a12-67.akam.net 184.26.160.67
a11-66.akam.net 84.53.139.66
a1-27.akam.net 193.108.91.27
a13-64.akam.net 2.22.230.64
a18-65.akam.net 95.101.36.65
a24-66.akam.net 2.16.130.66


Need to find out who hosts Yesbank.co.in?


Domain Registration (WhoIs) information for Yesbank.co.in

 Domain Name: yesbank.co.in
Registry Domain ID: D12131-IN
Registrar WHOIS Server:
Registrar URL: https://www.cscglobal.com/global/web/csc/home
Updated Date: 2020-10-16T06:01:41Z
Creation Date: 2004-04-02T20:53:34Z
Registry Expiry Date: 2022-04-02T19:53:34Z
Registrar: CSC Corporate Domains, Inc.
Registrar IANA ID: 299
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: YES Bank Ltd
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: MH
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: IN
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: a18-65.akam.net
Name Server: a11-66.akam.net
Name Server: a13-64.akam.net
Name Server: a12-67.akam.net
Name Server: a24-66.akam.net
Name Server: a1-27.akam.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-07T11:01:31Z

Websites with Similar Names

Yesbaazaar.site
yesbaazaar.site - Crazy Domains
Yesbaazarfinance.com
Yes Baazar Finance | Home
Yesbabeyes.store
Yes Babe Yes – Yes Babe Yes
Yesbaby.club
yesbaby.club
Yesbaby.online
yesbaby.online - Registered at Namecheap.com
Yesbaby.store
Just for kids Store
Yesbaby86.com
HostGator - Please Configure Your Name Servers
Yesbabycams.com
Home | yesbaby

Recently Updated Websites

Snowcap-games.com (1 second ago.)Gauravkathuria.net (1 second ago.)Companytokenization.com (2 seconds ago.)Reliancereal.estate (2 seconds ago.)Rebs.tech (2 seconds ago.)Honoursadmission.org (2 seconds ago.)Jinglepods.com (2 seconds ago.)Smarthosie.com (3 seconds ago.)Enchiclayo.com (3 seconds ago.)Transamericadirect.com (3 seconds ago.)Personalitytutor.com (3 seconds ago.)Howestreetgallery.com (4 seconds ago.)Quotespalace.com (4 seconds ago.)Sumirearc.com (4 seconds ago.)Moderndefense.net (4 seconds ago.)Volendambikerental.com (4 seconds ago.)Janeteashton.com (4 seconds ago.)He-intl-dubai-villas-ray.live (4 seconds ago.)Swoleseafoods.com (4 seconds ago.)Srisivansar.org (4 seconds ago.)Travelateaseglobal.com (4 seconds ago.)Kiteschoolturkey.com (5 seconds ago.)Ultramarbella.com (5 seconds ago.)Allureomaha.com (5 seconds ago.)Jsaas-valuation.com (5 seconds ago.)Oguzuzun.com (5 seconds ago.)Ggd-inc.com (5 seconds ago.)Hollywoodfitness.net (5 seconds ago.)Dilapidationssurvey.com (5 seconds ago.)Ln-cc.com (5 seconds ago.)

Recently Searched Keywords

michelleobryan (4 seconds ago.)marine diesel tank (6 seconds ago.)uic sanatu, llc (8 seconds ago.)0px border-left-width (8 seconds ago.)4px -webkit-border-radius (9 seconds ago.)abokarte kaufen (10 seconds ago.)ecco tred tray (11 seconds ago.)las necesidades (12 seconds ago.)tensol energía solar (13 seconds ago.)oak (14 seconds ago.)million to billion (14 seconds ago.)tomurcuk oyuncak sanayi (14 seconds ago.)1c1c1c ffwdcontainer10 (15 seconds ago.)pp codepsngratuit.net (16 seconds ago.)lac operon (17 seconds ago.)rental (18 seconds ago.)dildo1.57m (20 seconds ago.)аланья (22 seconds ago.)teche-electric (22 seconds ago.)newurl (23 seconds ago.)forward through chaosquick viewwristbandprice$3.00 (25 seconds ago.)normal normal 17px21px (25 seconds ago.)fire bowls (27 seconds ago.)homecontactcastcrewphotospress (31 seconds ago.)remake of my fancy padlet (33 seconds ago.)none position (40 seconds ago.)mais notcias (41 seconds ago.)testing for schools maths (42 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (42 seconds ago.)legal-document-listtype1 titlebefore content (43 seconds ago.)