Yeswegreen.org Favicon Yeswegreen.org

Yeswegreen.org Website Thumbnail
Checking...
YesWeGreen - Pour Vivre Green et consommer local
Low trust score
Add a review Change category Claim this site
Expériences green, insolites et inédites à Paris. DIY, Cuisine locavore, Upcycling, Apiculture urbaine, Vins naturels, il y en a pour tous les goûts...


Domain summary

Domain label
yeswegreen
Domain extension
org
Domain registered:
2015-05-25
Domain updated:
2020-09-27
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is yeswegreen.org ranked relative to other sites:

Percentage of visits to yeswegreen.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Yeswegreen.org registered?
A: Yeswegreen.org was registered 5 years, 4 months, 4 weeks, 21 hours, 3 minutes, 7 seconds ago on Monday, May 25, 2015.
Q: When was the WHOIS for Yeswegreen.org last updated?
A: The WHOIS entry was last updated 3 weeks, 4 days, 21 hours, 3 minutes, 7 seconds ago on Sunday, September 27, 2020.
Q: What are Yeswegreen.org's nameservers?
A: DNS for Yeswegreen.org is provided by the following nameservers:
  • ns-164-c.gandi.net
Q: Who is the registrar for the Yeswegreen.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Yeswegreen.org?
A: Yeswegreen.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Yeswegreen.org each day?
A: Yeswegreen.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Yeswegreen.org resolve to?
A: Yeswegreen.org resolves to the IPv4 address 91.132.145.206.
Q: In what country are Yeswegreen.org servers located in?
A: Yeswegreen.org has servers located in the Germany.
Q: What webserver software does Yeswegreen.org use?
A: Yeswegreen.org is powered by Openresty webserver.
Q: Who hosts Yeswegreen.org?
A: Yeswegreen.org is hosted by TELE2 in Germany.
Q: How much is Yeswegreen.org worth?
A: Yeswegreen.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Yeswegreen.org?

Yeswegreen.org Hosting Provider Information

Hosted IP Address:91.132.145.206
Hosted Hostname:yeswegreen.org
Service Provider:TELE2
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:openresty

Is "TELE2" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Yeswegreen.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: openresty
Date: Sun, 27 Sep 2020 22:00:31 GMT
Content-Type: text/html
Content-Length: 166
Connection: keep-alive
Location: https://yeswegreen.org/

Yeswegreen.org Domain Nameserver Information

HostIP AddressCountry
ns-164-c.gandi.net 217.70.187.165France France


Need to find out who hosts Yeswegreen.org?


WhoIs information for Yeswegreen.org

 Domain Name: YESWEGREEN.ORG
Registry Domain ID: D176345245-LROR
Registrar WHOIS Server: whois.gandi.net
Registrar URL: http://www.gandi.net
Updated Date: 2020-05-12T02:24:34Z
Creation Date: 2015-05-25T15:49:21Z
Registry Expiry Date: 2021-05-25T15:49:21Z
Registrar Registration Expiration Date:
Registrar: Gandi SAS
Registrar IANA ID: 81
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33.170377661
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: FR
Name Server: NS-66-B.GANDI.NET
Name Server: NS-164-C.GANDI.NET
Name Server: NS-73-A.GANDI.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-27T21:59:33Z

Yeswegreen.org Free SEO Report

Website Inpage Analysis for Yeswegreen.org

H1 Headings

8 :
  1. Des nouveaux ateliers pour la rentrée!
  2. Une première: lancement des produits pour poursuivre l'expérience green !
  3. C'est la rentrée scolaire, inscrivez vos enfants à des Forest Schools !
  4. Participez à des ateliers en toute sérénité avec les ateliers @DISTANCE
  5. Week-end nature
  6. Des EVJF pas comme les autres...
  7. Activités en amoureux
  8. Essayez le zéro déchet

H2 Headings

118 :
  1. Quelle expérience green souhaitez-vous ?
  2. Dans quel univers ?
  3. Des nouveaux ateliers pour la rentrée!
  4. Suspensions florales : atelier création de déco à partir de collants filés et recyclés
  5. Safran : atelier récolte sur un toit parisien
  6. Permaculture : atelier initiation au maraîchage naturel
  7. Pâtes fraiches et artisanales : atelier fabrication d’un produit mythique, bio et local
  8. Huiles essentielles : atelier initiation à l’art de l’aromathérapie
  9. Herboristerie : à la découverte des bienfaits de la médecine naturelle
  10. Guirlande et masque d’Halloween : atelier création en papier découpé
  11. Entreprises: chantiers dans une ferme urbaine
  12. Entreprises: ateliers dans une ferme urbaine
  13. Enfants: abonnement annuel Forest School Paris 17ème
  14. Cuisine ayurvédique : atelier création d’un repas à l’écoute de son corps
  15. Café : atelier apprenti barista
  16. Broderie : atelier pour donner une seconde vie à vos vêtements usagés
  17. Boucles d’oreilles : atelier création à partir de collants recyclés
  18. Apiculture : atelier découverte des secrets des abeilles dans une ferme urbaine
  19. Savon local au miel parisien et calendula, Paris 7
  20. Plants bios et non hybridés: abonnement annuel, Paris 20
  21. Safran: kit 0,5g + carnet de recettes
  22. Safran 0,1g, Paris 7
  23. Plants bios et non hybridés: abonnement annuel, Paris 11
  24. Champagne: kit pour un apéro local et green “du caractère dans ton verre”
  25. Faire sa propre mozzarella: kit complet
  26. Pâtes fraiches: abonnement annuel, Paris 5
  27. Buratta/mozza: abonnement annuel, Paris 5
  28. Vins naturels: kit oenologie 12 bouteilles
  29. Champagnes naturels: open bar
  30. C'est la rentrée scolaire, inscrivez vos enfants à des Forest Schools !
  31. Enfants: abonnement annuel Forest School Paris Nanterre
  32. Enfants: abonnement annuel Forest School Paris Meudon
  33. Enfants: abonnement annuel Forest School Paris 7ème
  34. Enfants: abonnement annuel Forest School Paris 19ème
  35. Enfants: abonnement annuel Forest School Paris 17ème
  36. Enfants: abonnement annuel Forest School Paris 16ème
  37. Enfants: abonnement annuel Forest School Paris 15ème
  38. Enfants: abonnement annuel Forest School Paris 14ème
  39. Enfants: abonnement annuel Forest School Paris 12ème
  40. Participez à des ateliers en toute sérénité avec les ateliers @DISTANCE
  41. Yoga sur chaise : atelier bien-être de chez vous
  42. Cuisine ayurvédique : atelier création d’un repas éthique et écologique
  43. @Distance Soin zen : Fabrication d’une barre de massage
  44. @Distance Soin visage : Démaquillant biphasé
  45. @Distance Lèvres : Baume et gommage
  46. @Distance Cuisine : burgers et mousses au chocolat healthy et vegan
  47. @Distance Cuisine : Apéro croquant aux accents orientaux & salade de fruits estivales
  48. @Distance Corps : Gommage ou huile de beauté soleil ou huile de douche gourmande
  49. @Distance Atelier soins visage : Fabrication d’un nettoyant démaquillant et d’un serum hydratant
  50. @Distance Atelier soins cheveux au naturel
  51. @Distance Atelier Shampoing solide zéro déchet
  52. @Distance Atelier Huile sublimante
  53. @Distance Atelier Huile de soin pour la barbe
  54. @Distance Atelier déodorant zéro déchet
  55. @Distance : Fabrication de produits ménagers
  56. @Distance – Yoga apéro – Initiation au Yoga et dégustation de vins naturels
  57. @Distance – Jardinage
  58. @Distance – Fabrication de produits ménagers – Initiation à la maison zéro déchet
  59. @Distance – Atelier premium – Fabrication de mozzarella et de burrata
  60. @Distance – Atelier d’Aromathérapie – Fabrication d’un roll-on de poche
  61. Enfants: abonnement annuel Forest School Paris 17ème
  62. Apiculture : atelier découverte des secrets des abeilles dans une ferme urbaine
  63. Safran : atelier visite de la plantation et dégustation sur les toits de Paris
  64. Permaculture : atelier initiation au maraîchage naturel
  65. Plantes sauvages : atelier balade urbaine, les effets thérapeutiques des plantes
  66. Petit terrarium en bocal : atelier création d’un aquarium végétal
  67. Safran : atelier récolte sur un toit parisien
  68. Bouquet de fleurs : atelier confection d’un bouquet champêtre
  69. Terrarium : atelier création d’un aquarium végétal
  70. Apiculture : stage de 2 jours sur les secrets du métier d’apiculteur
  71. Bague, bracelet, boucle d’oreille, collier, ou bandeau : atelier création à partir de collants recyclés
  72. Cosmétique naturelle : 3 produits personnalisés (sérum nuit, crème de jour et lotion tonique)
  73. Cosmétiques naturels : atelier création de soins personnalisables
  74. Crème visage et baume à lèvre : atelier création de cosmétiques au miel naturel
  75. Cuisine végane : Balade et dégustation guidée dans Paris
  76. Fabrication d’un kit cosmétique Zéro Déchets – Tassin-la-Demi-lune (Lyon)
  77. Fabrication de cosmétiques naturels (Tassin-la-Demi-Lune et Lyon)
  78. Fabrication de cosmétiques naturels à Lyon
  79. Shampoing, déo et dentifrice solide : trio de cosmétiques zéro déchet
  80. Vins : atelier dégustation avec un caviste bio, sans sulfites ajoutés et en biodynamie
  81. Vins : Atelier rencontre d’un vigneron et dégustation de 4 cuvées naturelles
  82. Vins naturels et planche végétarienne : atelier dégustation avec une sommelière passionnée
  83. Yoga apéro : atelier initiation + dégustation de vins naturels et d’une planche vegan
  84. Mozzarella et burrata : atelier création d’un produit mythique, bio et local
  85. Pâtes fraiches et artisanales : atelier fabrication d’un produit mythique, bio et local
  86. Vins : atelier dégustation avec un caviste bio, sans sulfites ajoutés et en biodynamie
  87. Champagne : atelier dégustation des 4 grands terroirs champenois
  88. Safran : atelier récolte sur un toit parisien
  89. Apiculture : atelier découverte des secrets des abeilles dans une ferme urbaine
  90. Café : atelier apprenti barista
  91. Vins naturels et planche végétarienne : atelier dégustation avec une sommelière passionnée
  92. Atelier cuisine zéro déchet
  93. Atelier salle de bain zéro déchet
  94. Cabane à chat en carton : atelier création upcycling
  95. Entretenir sa cuisine : Fabrication de produits ménagers
  96. Entretenir ses sanitaires : Fabrication de produits ménagers
  97. Fabrication d’un “kit récur” zéro déchet – Tassin-la-Demi-lune (Lyon)
  98. Fabrication d’un kit cosmétique Zéro Déchets – Tassin-la-Demi-lune (Lyon)
  99. Fabriquez vos produits d’entretien zéro déchets!
  100. Fabriquez vos produits d’hygiène zéro déchets!
  101. Fabriquez vos soins de beauté naturels!
  102. Lampe lotus en carton : atelier création upcycling
  103. Lessive en poudre, spray nettoyant et poudre de lave-vaiselle : atelier création de produits ménagers
  104. Lustre diamant en carton : atelier création upcycling
  105. Nettoyer sa maison au naturel : Fabrication de produits ménagers
  106. Soin du linge : Fabrication de produits ménagers
  107. Table de chevet : atelier création d’un meuble en carton upcyclé
  108. Près de chez vous
  109. Près de chez vous
  110. Biot
  111. Bordeaux
  112. Cannes
  113. Lyon
  114. Montpellier
  115. Nantes
  116. Paris
  117. Reims
  118. Toulouse

H3 Headings

5 :
  1. Notre engagement pour la meilleure
  2. VRAIMENT GREEN
  3. SAVOIR-FAIRE TRANSMIS
  4. POUR TOUS
  5. EXPERTS

H4 Headings

9 :
  1. Succombez à des EVJF hors normes, éco-responsables, avec des expert(e)s engagés. Que ce soient des fabrications de cosmétiques naturelles, couronnes de fleurs séchées, cours de yoga avec assiette vegan, ou encore dégustation de vins biodynamiques et fabrication de déco upcycling, vous passerez un bon moment de détente, de plaisir et d'apprentissage!
  2. Partagez un bon moment à deux, dans une ambiance éco-reponsable! Apprenez à fabriquer de la mozzarella avec une experte italienne, montez sur les toits de Paris pour récolter du safran, dégustez des vins naturels, biodynamiques, devenez apprenti barista en apprenant tous les secrets du café, ou initiez vous à l'apiculture dans une ferme urbaine!
  3. Initiez vous au zéro déchet: salle de bain, cuisine, cosmétique, et même déco, tout est possible!
  4. QUI SOMMES-NOUS ?
  5. Entreprise
  6. Partenaire
  7. Notre offre
  8. Ne loupez rien !
  9. Politique de confidentialité

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

251 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-173918951-1

Links - Internal

259:
  1. No text
    http://yeswegreen.org/
  2. Univers Green
    https://yeswegreen.org/boutique/
  3. Beauté naturelle
    https://yeswegreen.org/categorie-produit/atelier/beaute-naturelle/?products-per-page=all
  4. Nature urbaine
    https://yeswegreen.org/categorie-produit/atelier/nature/?products-per-page=all
  5. Food locavore
    https://yeswegreen.org/categorie-produit/atelier/food-locavore/?products-per-page=all
  6. Déco upcycling
    https://yeswegreen.org/categorie-produit/atelier/deco-upcycling/?products-per-page=all
  7. Home zéro déchet
    https://yeswegreen.org/categorie-produit/atelier/home-zero-dechet/
  8. Attitude zen
    https://yeswegreen.org/categorie-produit/atelier/attitude-zen/?products-per-page=all
  9. Slow fashion
    https://yeswegreen.org/categorie-produit/atelier/slow-fashion/?products-per-page=all
  10. Spécial enfants
    https://yeswegreen.org/categorie-produit/atelier/special-enfants/?products-per-page=all
  11. Spécial vegan
    https://yeswegreen.org/categorie-produit/atelier/special-vegan/?products-per-page=all
  12. Spécial English speaker
    https://yeswegreen.org/categorie-produit/atelier/special-english-speaker/?products-per-page=all
  13. Vos évènements
    https://yeswegreen.org/categorie-produit/atelier/vos-evenements/
  14. Ateliers engagés
    https://yeswegreen.org/boutique/
  15. Ateliers chez vous chez nous
    https://yeswegreen.org/categorie-produit/atelier+ateliers-chez-vous-chez-nous/
  16. @distance
    https://yeswegreen.org/categorie-produit/atelier/distance/?products-per-page=all
  17. Spécial entreprise
    https://yeswegreen.org/categorie-produit/atelier/noel/
  18. Produits locaux
    https://yeswegreen.org/categorie-produit/produits/?products-per-page=all
  19. Food locavore
    https://yeswegreen.org/categorie-produit/produits+food-locavore/
  20. Nature urbaine
    https://yeswegreen.org/categorie-produit/produits+nature/
  21. Beauté naturelle
    https://yeswegreen.org/categorie-produit/produits+beaute-naturelle/
  22. Cartes cadeaux
    https://yeswegreen.org/categorie-produit/carte-cadeau/
  23. Demande de privatisation
    http://yeswegreen.org/formulaire-demande-groupe/
  24. Notre charte
    https://yeswegreen.org/notre-charte-2/
  25. Mon Compte
    https://yeswegreen.org/mon-compte/
  26. Commandes
    https://yeswegreen.org/mon-compte/orders/
  27. EN
    https://yeswegreen.org/en/
  28. Découvrir
    https://yeswegreen.org/boutique/
  29. DÉCOUVREZ TOUS LES SECRETS DE SA CULTURE URBAINE
    https://yeswegreen.org/experiences/visite-ferme-urbaine-et-recolte-de-safran-repartez-avec-votre-dose-de-safran/
  30. EXPLOREZ NOS EXPÉRIENCES GREEN AU GRAND AIR
    https://yeswegreen.org/categorie-produit/atelier/nature/?products-per-page=all
  31. Cartes cadeaux
    http://yeswegreen.org/categorie-produit/carte-cadeau/
  32. Ateliers chez nous ou chez vous
    https://yeswegreen.org/categorie-produit/atelier+ateliers-chez-vous-chez-nous/
  33. Atelier @Distance
    https://yeswegreen.org/categorie-produit/atelier/distance/?products-per-page=all
  34. Ateliers Spéciaux Entreprise
    https://yeswegreen.org/categorie-produit/atelier/noel/
  35. Produits
    https://yeswegreen.org/categorie-produit/produits/?products-per-page=all
  36. Attitude zen
    http://yeswegreen.org/categorie-produit/atelier/attitude-zen/?products-per-page=all
  37. Beauté naturelle
    http://yeswegreen.org/categorie-produit/atelier/beaute-naturelle/?products-per-page=all
  38. Spécial Vacances
    https://yeswegreen.org/categorie-produit/atelier/vacances/?products-per-page=all
  39. Déco upcycling
    http://yeswegreen.org/categorie-produit/atelier/deco-upcycling/?products-per-page=all
  40. Home zero déchet
    https://yeswegreen.org/categorie-produit/atelier/home-zero-dechet/
  41. Nature urbaine
    http://yeswegreen.org/categorie-produit/atelier/nature/?products-per-page=all
  42. Slow fashion
    http://yeswegreen.org/categorie-produit/atelier/slow-fashion/?products-per-page=all
  43. Spécial enfants
    http://yeswegreen.org/categorie-produit/atelier/special-enfants/?products-per-page=all
  44. Special english speaker
    http://yeswegreen.org/categorie-produit/atelier/special-english-speaker/?products-per-page=all
  45. Spécial vegan
    http://yeswegreen.org/categorie-produit/atelier/special-vegan/?products-per-page=all
  46. No text
    https://yeswegreen.org/experiences/suspensions-florales-atelier-creation-de-deco-a-partir-de-collants-files-et-recycles/
  47. Suspensions florales : atelier création de déco à partir de collants filés et recyclés
    https://yeswegreen.org/experiences/suspensions-florales-atelier-creation-de-deco-a-partir-de-collants-files-et-recycles/
  48. No text
    https://yeswegreen.org/experiences/safran-atelier-recolte-sur-un-toit-parisien/
  49. Safran : atelier récolte sur un toit parisien
    https://yeswegreen.org/experiences/safran-atelier-recolte-sur-un-toit-parisien/
  50. No text
    https://yeswegreen.org/experiences/permaculture-atelier-initiation-au-maraichage-naturel/
  51. Permaculture : atelier initiation au maraîchage naturel
    https://yeswegreen.org/experiences/permaculture-atelier-initiation-au-maraichage-naturel/
  52. No text
    https://yeswegreen.org/experiences/pates-fraiches-et-artisanales-atelier-fabrication-dun-produit-mythique-bio-et-local/
  53. Pâtes fraiches et artisanales : atelier fabrication d’un produit mythique, bio et local
    https://yeswegreen.org/experiences/pates-fraiches-et-artisanales-atelier-fabrication-dun-produit-mythique-bio-et-local/
  54. No text
    https://yeswegreen.org/experiences/huiles-essentielles-atelier-initiation-a-lart-de-laromatherapie/
  55. Huiles essentielles : atelier initiation à l’art de l’aromathérapie
    https://yeswegreen.org/experiences/huiles-essentielles-atelier-initiation-a-lart-de-laromatherapie/
  56. No text
    https://yeswegreen.org/experiences/herboristerie-a-la-decouverte-des-bienfaits-de-la-medecine-naturelle/
  57. Herboristerie : à la découverte des bienfaits de la médecine naturelle
    https://yeswegreen.org/experiences/herboristerie-a-la-decouverte-des-bienfaits-de-la-medecine-naturelle/
  58. No text
    https://yeswegreen.org/experiences/guirlande-et-masque-dhalloween-atelier-creation-en-papier-decoupe/
  59. Guirlande et masque d’Halloween : atelier création en papier découpé
    https://yeswegreen.org/experiences/guirlande-et-masque-dhalloween-atelier-creation-en-papier-decoupe/
  60. No text
    https://yeswegreen.org/experiences/entreprises-chantiers-dans-une-ferme-urbaine/
  61. Entreprises: chantiers dans une ferme urbaine
    https://yeswegreen.org/experiences/entreprises-chantiers-dans-une-ferme-urbaine/
  62. No text
    https://yeswegreen.org/experiences/entreprises-ateliers-dans-une-ferme-urbaine/
  63. Entreprises: ateliers dans une ferme urbaine
    https://yeswegreen.org/experiences/entreprises-ateliers-dans-une-ferme-urbaine/
  64. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-17eme/
  65. Enfants: abonnement annuel Forest School Paris 17ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-17eme/
  66. No text
    https://yeswegreen.org/experiences/cuisine-ayurvedique-atelier-creation-dun-repas-a-lecoute-de-son-corps/
  67. Cuisine ayurvédique : atelier création d’un repas à l’écoute de son corps
    https://yeswegreen.org/experiences/cuisine-ayurvedique-atelier-creation-dun-repas-a-lecoute-de-son-corps/
  68. No text
    https://yeswegreen.org/experiences/atelier-apprenti-barista/
  69. Café : atelier apprenti barista
    https://yeswegreen.org/experiences/atelier-apprenti-barista/
  70. No text
    https://yeswegreen.org/experiences/broderie-atelier-pour-donner-une-seconde-vie-a-vos-vetements-usages/
  71. Broderie : atelier pour donner une seconde vie à vos vêtements usagés
    https://yeswegreen.org/experiences/broderie-atelier-pour-donner-une-seconde-vie-a-vos-vetements-usages/
  72. No text
    https://yeswegreen.org/experiences/boucles-doreilles-atelier-creation-a-partir-de-collants-recycles/
  73. Boucles d’oreilles : atelier création à partir de collants recyclés
    https://yeswegreen.org/experiences/boucles-doreilles-atelier-creation-a-partir-de-collants-recycles/
  74. No text
    https://yeswegreen.org/experiences/apiculture-atelier-decouverte-des-secrets-des-abeilles-dans-une-ferme-urbaine/
  75. Apiculture : atelier découverte des secrets des abeilles dans une ferme urbaine
    https://yeswegreen.org/experiences/apiculture-atelier-decouverte-des-secrets-des-abeilles-dans-une-ferme-urbaine/
  76. No text
    https://yeswegreen.org/experiences/savon-au-miel-et-calendula/
  77. Savon local au miel parisien et calendula, Paris 7
    https://yeswegreen.org/experiences/savon-au-miel-et-calendula/
  78. No text
    https://yeswegreen.org/experiences/abonnement-annuel-plants-addict-20eme-arrondissement/
  79. Plants bios et non hybridés: abonnement annuel, Paris 20
    https://yeswegreen.org/experiences/abonnement-annuel-plants-addict-20eme-arrondissement/
  80. No text
    https://yeswegreen.org/experiences/kit-safran-05g-carnet-de-recettes/
  81. Safran: kit 0,5g + carnet de recettes
    https://yeswegreen.org/experiences/kit-safran-05g-carnet-de-recettes/
  82. No text
    https://yeswegreen.org/experiences/dose-de-safran-parisien-01g/
  83. Safran 0,1g, Paris 7
    https://yeswegreen.org/experiences/dose-de-safran-parisien-01g/
  84. No text
    https://yeswegreen.org/experiences/abonnement-annuel-plants-addict-11eme-arrondissement/
  85. Plants bios et non hybridés: abonnement annuel, Paris 11
    https://yeswegreen.org/experiences/abonnement-annuel-plants-addict-11eme-arrondissement/
  86. No text
    https://yeswegreen.org/experiences/tote-bag-garni-pour-un-apero-local-et-green-du-caractere-dans-ton-verre/
  87. Champagne: kit pour un apéro local et green “du caractère dans ton verre”
    https://yeswegreen.org/experiences/tote-bag-garni-pour-un-apero-local-et-green-du-caractere-dans-ton-verre/
  88. No text
    https://yeswegreen.org/experiences/kit-farbication-mozarrella-paris/
  89. Faire sa propre mozzarella: kit complet
    https://yeswegreen.org/experiences/kit-farbication-mozarrella-paris/
  90. No text
    https://yeswegreen.org/experiences/abonnement-annuel-pasta-lovers/
  91. Pâtes fraiches: abonnement annuel, Paris 5
    https://yeswegreen.org/experiences/abonnement-annuel-pasta-lovers/
  92. No text
    https://yeswegreen.org/experiences/abonnement-burrata-paris-produit-un-an/
  93. Buratta/mozza: abonnement annuel, Paris 5
    https://yeswegreen.org/experiences/abonnement-burrata-paris-produit-un-an/
  94. No text
    https://yeswegreen.org/experiences/pack-decouverte-12-bouteilles-de-vin-naturel/
  95. Vins naturels: kit oenologie 12 bouteilles
    https://yeswegreen.org/experiences/pack-decouverte-12-bouteilles-de-vin-naturel/
  96. No text
    https://yeswegreen.org/experiences/open-bar-champagnes-naturels-decouverte-paris/
  97. Champagnes naturels: open bar
    https://yeswegreen.org/experiences/open-bar-champagnes-naturels-decouverte-paris/
  98. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-nanterre/
  99. Enfants: abonnement annuel Forest School Paris Nanterre
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-nanterre/
  100. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-meudon/
  101. Enfants: abonnement annuel Forest School Paris Meudon
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-meudon/
  102. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-7eme/
  103. Enfants: abonnement annuel Forest School Paris 7ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-7eme/
  104. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-19eme/
  105. Enfants: abonnement annuel Forest School Paris 19ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-19eme/
  106. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-16eme/
  107. Enfants: abonnement annuel Forest School Paris 16ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-16eme/
  108. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-15eme/
  109. Enfants: abonnement annuel Forest School Paris 15ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-15eme/
  110. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-14eme/
  111. Enfants: abonnement annuel Forest School Paris 14ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-14eme/
  112. No text
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-12eme/
  113. Enfants: abonnement annuel Forest School Paris 12ème
    https://yeswegreen.org/experiences/enfants-abonnement-annuel-forest-school-paris-12eme/
  114. No text
    https://yeswegreen.org/experiences/yoga-sur-chaise-atelier-bien-etre-de-chez-vous/
  115. Yoga sur chaise : atelier bien-être de chez vous
    https://yeswegreen.org/experiences/yoga-sur-chaise-atelier-bien-etre-de-chez-vous/
  116. No text
    https://yeswegreen.org/experiences/cuisine-ayurvedique-atelier-creation-dun-repas-ethique-et-ecologique/
  117. Cuisine ayurvédique : atelier création d’un repas éthique et écologique
    https://yeswegreen.org/experiences/cuisine-ayurvedique-atelier-creation-dun-repas-ethique-et-ecologique/
  118. No text
    https://yeswegreen.org/experiences/distance-soin-zen-fabrication-dune-barre-de-massage/
  119. @Distance Soin zen : Fabrication d’une barre de massage
    https://yeswegreen.org/experiences/distance-soin-zen-fabrication-dune-barre-de-massage/
  120. No text
    https://yeswegreen.org/experiences/distance-soin-visage-demaquillant-biphase/
  121. @Distance Soin visage : Démaquillant biphasé
    https://yeswegreen.org/experiences/distance-soin-visage-demaquillant-biphase/
  122. No text
    https://yeswegreen.org/experiences/distance-levres-baume-et-gommage/
  123. @Distance Lèvres : Baume et gommage
    https://yeswegreen.org/experiences/distance-levres-baume-et-gommage/
  124. No text
    https://yeswegreen.org/experiences/distance-cuisine-burgers-et-mousse-au-chocolat-healthy-et-vegan/
  125. @Distance Cuisine : burgers et mousses au chocolat healthy et vegan
    https://yeswegreen.org/experiences/distance-cuisine-burgers-et-mousse-au-chocolat-healthy-et-vegan/
  126. No text
    https://yeswegreen.org/experiences/distance-cuisine-apero-croquant-aux-accents-orientaux-salade-dete/
  127. @Distance Cuisine : Apéro croquant aux accents orientaux & salade de fruits estivales
    https://yeswegreen.org/experiences/distance-cuisine-apero-croquant-aux-accents-orientaux-salade-dete/
  128. No text
    https://yeswegreen.org/experiences/distance-corps-gommage-ou-huile-de-beaute-soleil-ou-huile-de-douche-gourmande/
  129. @Distance Corps : Gommage ou huile de beauté soleil ou huile de douche gourmande
    https://yeswegreen.org/experiences/distance-corps-gommage-ou-huile-de-beaute-soleil-ou-huile-de-douche-gourmande/
  130. No text
    https://yeswegreen.org/experiences/distance-atelier-soins-visage-fabrication-dun-nettoyant-demaquillant-et-dun-serum-hydratant/
  131. @Distance Atelier soins visage : Fabrication d’un nettoyant démaquillant et d’un serum hydratant
    https://yeswegreen.org/experiences/distance-atelier-soins-visage-fabrication-dun-nettoyant-demaquillant-et-dun-serum-hydratant/
  132. No text
    https://yeswegreen.org/experiences/distance-atelier-soin-cheveux-au-naturel/
  133. @Distance Atelier soins cheveux au naturel
    https://yeswegreen.org/experiences/distance-atelier-soin-cheveux-au-naturel/
  134. No text
    https://yeswegreen.org/experiences/distance-atelier-shampoing-solide-zero-dechet/
  135. @Distance Atelier Shampoing solide zéro déchet
    https://yeswegreen.org/experiences/distance-atelier-shampoing-solide-zero-dechet/
  136. No text
    https://yeswegreen.org/experiences/distance-atelier-huile-sublimante-special-fete-des-meres/
  137. @Distance Atelier Huile sublimante
    https://yeswegreen.org/experiences/distance-atelier-huile-sublimante-special-fete-des-meres/
  138. No text
    https://yeswegreen.org/experiences/distance-atelier-huile-de-soin-pour-la-barbe-special-fete-des-peres/
  139. @Distance Atelier Huile de soin pour la barbe
    https://yeswegreen.org/experiences/distance-atelier-huile-de-soin-pour-la-barbe-special-fete-des-peres/
  140. No text
    https://yeswegreen.org/experiences/distance-atelier-deodorant-zero-dechet/
  141. @Distance Atelier déodorant zéro déchet
    https://yeswegreen.org/experiences/distance-atelier-deodorant-zero-dechet/
  142. No text
    https://yeswegreen.org/experiences/distance-fabrication-de-produits-menagers/
  143. @Distance : Fabrication de produits ménagers
    https://yeswegreen.org/experiences/distance-fabrication-de-produits-menagers/
  144. No text
    https://yeswegreen.org/experiences/distance-yoga-apero-initiation-au-yoga-et-degustation-de-vins-naturels/
  145. @Distance – Yoga apéro – Initiation au Yoga et dégustation de vins naturels
    https://yeswegreen.org/experiences/distance-yoga-apero-initiation-au-yoga-et-degustation-de-vins-naturels/
  146. No text
    https://yeswegreen.org/experiences/distance-jardinage/
  147. @Distance – Jardinage
    https://yeswegreen.org/experiences/distance-jardinage/
  148. No text
    https://yeswegreen.org/experiences/atelier-produits-menagers-zero-dechet/
  149. @Distance – Fabrication de produits ménagers – Initiation à la maison zéro déchet
    https://yeswegreen.org/experiences/atelier-produits-menagers-zero-dechet/
  150. No text
    https://yeswegreen.org/experiences/atelier-premium-mozzarella-burrata-bio-et-locale/
  151. @Distance – Atelier premium – Fabrication de mozzarella et de burrata
    https://yeswegreen.org/experiences/atelier-premium-mozzarella-burrata-bio-et-locale/
  152. No text
    https://yeswegreen.org/experiences/atelier-aromatherapie-2/
  153. @Distance – Atelier d’Aromathérapie – Fabrication d’un roll-on de poche
    https://yeswegreen.org/experiences/atelier-aromatherapie-2/
  154. No text
    https://yeswegreen.org/experiences/safran-atelier-visite-de-la-plantation-et-degustation-sur-les-toits-de-paris/
  155. Safran : atelier visite de la plantation et dégustation sur les toits de Paris
    https://yeswegreen.org/experiences/safran-atelier-visite-de-la-plantation-et-degustation-sur-les-toits-de-paris/
  156. No text
    https://yeswegreen.org/experiences/plantes-sauvages-atelier-balade-urbaine-les-effets-therapeutiques-des-plantes/
  157. Plantes sauvages : atelier balade urbaine, les effets thérapeutiques des plantes
    https://yeswegreen.org/experiences/plantes-sauvages-atelier-balade-urbaine-les-effets-therapeutiques-des-plantes/
  158. No text
    https://yeswegreen.org/experiences/petit-terrarium-en-bocal-atelier-creation-dun-aquarium-vegetal/
  159. Petit terrarium en bocal : atelier création d’un aquarium végétal
    https://yeswegreen.org/experiences/petit-terrarium-en-bocal-atelier-creation-dun-aquarium-vegetal/
  160. No text
    https://yeswegreen.org/experiences/bouquet-de-fleurs-atelier-confection-dun-bouquet-champetre/
  161. Bouquet de fleurs : atelier confection d’un bouquet champêtre
    https://yeswegreen.org/experiences/bouquet-de-fleurs-atelier-confection-dun-bouquet-champetre/
  162. No text
    https://yeswegreen.org/experiences/terrarium-atelier-creation-dun-aquarium-vegetal/
  163. Terrarium : atelier création d’un aquarium végétal
    https://yeswegreen.org/experiences/terrarium-atelier-creation-dun-aquarium-vegetal/
  164. No text
    https://yeswegreen.org/experiences/apiculture-stage-de-2-jours-sur-les-secrets-du-metier-dapiculteur/
  165. Apiculture : stage de 2 jours sur les secrets du métier d’apiculteur
    https://yeswegreen.org/experiences/apiculture-stage-de-2-jours-sur-les-secrets-du-metier-dapiculteur/
  166. No text
    https://yeswegreen.org/experiences/bague-bracelet-boucle-doreille-collier-ou-bandeau-atelier-creation-a-partir-de-collants-recycles/
  167. Bague, bracelet, boucle d’oreille, collier, ou bandeau : atelier création à partir de collants recyclés
    https://yeswegreen.org/experiences/bague-bracelet-boucle-doreille-collier-ou-bandeau-atelier-creation-a-partir-de-collants-recycles/
  168. No text
    https://yeswegreen.org/experiences/3-produits-cosmetique-naturelle-atelier-toulouse/
  169. Cosmétique naturelle : 3 produits personnalisés (sérum nuit, crème de jour et lotion tonique)
    https://yeswegreen.org/experiences/3-produits-cosmetique-naturelle-atelier-toulouse/
  170. No text
    https://yeswegreen.org/experiences/cosmetiques-naturels-atelier-creation-de-soins-personnalisables/
  171. Cosmétiques naturels : atelier création de soins personnalisables
    https://yeswegreen.org/experiences/cosmetiques-naturels-atelier-creation-de-soins-personnalisables/
  172. No text
    https://yeswegreen.org/experiences/creme-visage-et-baume-a-levre-atelier-creation-de-cosmetiques-au-miel-naturel/
  173. Crème visage et baume à lèvre : atelier création de cosmétiques au miel naturel
    https://yeswegreen.org/experiences/creme-visage-et-baume-a-levre-atelier-creation-de-cosmetiques-au-miel-naturel/
  174. No text
    https://yeswegreen.org/experiences/cuisine-vegane-balade-et-degustation-guidee-dans-paris/
  175. Cuisine végane : Balade et dégustation guidée dans Paris
    https://yeswegreen.org/experiences/cuisine-vegane-balade-et-degustation-guidee-dans-paris/
  176. No text
    https://yeswegreen.org/experiences/fabrication-dun-kit-cosmetique-zero-dechets-tassin-la-demi-lune-lyon/
  177. Fabrication d’un kit cosmétique Zéro Déchets – Tassin-la-Demi-lune (Lyon)
    https://yeswegreen.org/experiences/fabrication-dun-kit-cosmetique-zero-dechets-tassin-la-demi-lune-lyon/
  178. No text
    https://yeswegreen.org/experiences/offre-groupe-fabrication-de-cosmetiques-naturels-a-lyon/
  179. Fabrication de cosmétiques naturels (Tassin-la-Demi-Lune et Lyon)
    https://yeswegreen.org/experiences/offre-groupe-fabrication-de-cosmetiques-naturels-a-lyon/
  180. No text
    https://yeswegreen.org/experiences/fabrication-de-cosmetiques-naturels-pour-evjf-a-lyon/
  181. Fabrication de cosmétiques naturels à Lyon
    https://yeswegreen.org/experiences/fabrication-de-cosmetiques-naturels-pour-evjf-a-lyon/
  182. No text
    https://yeswegreen.org/experiences/shampoing-deo-et-dentifrice-solide-trio-de-cosmetiques-zero-dechet/
  183. Shampoing, déo et dentifrice solide : trio de cosmétiques zéro déchet
    https://yeswegreen.org/experiences/shampoing-deo-et-dentifrice-solide-trio-de-cosmetiques-zero-dechet/
  184. No text
    https://yeswegreen.org/experiences/vins-atelier-degustation-avec-un-caviste-bio-sans-sulfites-ajoutes-et-en-biodynamie/
  185. Vins : atelier dégustation avec un caviste bio, sans sulfites ajoutés et en biodynamie
    https://yeswegreen.org/experiences/vins-atelier-degustation-avec-un-caviste-bio-sans-sulfites-ajoutes-et-en-biodynamie/
  186. No text
    https://yeswegreen.org/experiences/vins-atelier-rencontre-dun-vigneron-et-degustation-de-4-cuvees-naturelles/
  187. Vins : Atelier rencontre d’un vigneron et dégustation de 4 cuvées naturelles
    https://yeswegreen.org/experiences/vins-atelier-rencontre-dun-vigneron-et-degustation-de-4-cuvees-naturelles/
  188. No text
    https://yeswegreen.org/experiences/vins-naturels-et-planche-vegetarienne-atelier-degustation-avec-une-sommeliere-passionnee/
  189. Vins naturels et planche végétarienne : atelier dégustation avec une sommelière passionnée
    https://yeswegreen.org/experiences/vins-naturels-et-planche-vegetarienne-atelier-degustation-avec-une-sommeliere-passionnee/
  190. No text
    https://yeswegreen.org/experiences/yoga-apero-atelier-initiation-degustation-de-vins-naturels-et-dune-planche-vegan/
  191. Yoga apéro : atelier initiation + dégustation de vins naturels et d’une planche vegan
    https://yeswegreen.org/experiences/yoga-apero-atelier-initiation-degustation-de-vins-naturels-et-dune-planche-vegan/
  192. No text
    https://yeswegreen.org/experiences/mozzarella-et-de-burrata-atelier-creation-dun-produit-mythique-bio-et-local/
  193. Mozzarella et burrata : atelier création d’un produit mythique, bio et local
    https://yeswegreen.org/experiences/mozzarella-et-de-burrata-atelier-creation-dun-produit-mythique-bio-et-local/
  194. No text
    https://yeswegreen.org/experiences/champagne-atelier-degustation-des-4-grands-terroirs-champenois/
  195. Champagne : atelier dégustation des 4 grands terroirs champenois
    https://yeswegreen.org/experiences/champagne-atelier-degustation-des-4-grands-terroirs-champenois/
  196. No text
    https://yeswegreen.org/experiences/atelier-cuisine-zero-dechet/
  197. Atelier cuisine zéro déchet
    https://yeswegreen.org/experiences/atelier-cuisine-zero-dechet/
  198. No text
    https://yeswegreen.org/experiences/atelier-salle-de-bain-zero-dechet/
  199. Atelier salle de bain zéro déchet
    https://yeswegreen.org/experiences/atelier-salle-de-bain-zero-dechet/
  200. No text
    https://yeswegreen.org/experiences/cabane-a-chat-en-carton-atelier-creation-upcycling/
  201. Cabane à chat en carton : atelier création upcycling
    https://yeswegreen.org/experiences/cabane-a-chat-en-carton-atelier-creation-upcycling/
  202. No text
    https://yeswegreen.org/experiences/entretenir-sa-cuisine-fabrication-de-produits-menagers/
  203. Entretenir sa cuisine : Fabrication de produits ménagers
    https://yeswegreen.org/experiences/entretenir-sa-cuisine-fabrication-de-produits-menagers/
  204. No text
    https://yeswegreen.org/experiences/entretenir-ses-sanitaires-fabrication-de-produits-menagers/
  205. Entretenir ses sanitaires : Fabrication de produits ménagers
    https://yeswegreen.org/experiences/entretenir-ses-sanitaires-fabrication-de-produits-menagers/
  206. No text
    https://yeswegreen.org/experiences/fabrication-dun-kit-recur-zero-dechet-tassin-la-demi-lune-lyon/
  207. Fabrication d’un “kit récur” zéro déchet – Tassin-la-Demi-lune (Lyon)
    https://yeswegreen.org/experiences/fabrication-dun-kit-recur-zero-dechet-tassin-la-demi-lune-lyon/
  208. No text
    https://yeswegreen.org/experiences/fabriquez-vos-produits-dentretien-zero-dechets/
  209. Fabriquez vos produits d’entretien zéro déchets!
    https://yeswegreen.org/experiences/fabriquez-vos-produits-dentretien-zero-dechets/
  210. No text
    https://yeswegreen.org/experiences/fabriquez-vos-produits-dhygiene-zero-dechets/
  211. Fabriquez vos produits d’hygiène zéro déchets!
    https://yeswegreen.org/experiences/fabriquez-vos-produits-dhygiene-zero-dechets/
  212. No text
    https://yeswegreen.org/experiences/fabriquez-vos-soins-de-beaute-naturels/
  213. Fabriquez vos soins de beauté naturels!
    https://yeswegreen.org/experiences/fabriquez-vos-soins-de-beaute-naturels/
  214. No text
    https://yeswegreen.org/experiences/lampe-lotus-en-carton-atelier-creation-upcycling/
  215. Lampe lotus en carton : atelier création upcycling
    https://yeswegreen.org/experiences/lampe-lotus-en-carton-atelier-creation-upcycling/
  216. No text
    https://yeswegreen.org/experiences/lessive-en-poudre-spray-nettoyant-et-poudre-de-lave-vaiselle-atelier-creation-de-produits-menagers/
  217. Lessive en poudre, spray nettoyant et poudre de lave-vaiselle : atelier création de produits ménagers
    https://yeswegreen.org/experiences/lessive-en-poudre-spray-nettoyant-et-poudre-de-lave-vaiselle-atelier-creation-de-produits-menagers/
  218. No text
    https://yeswegreen.org/experiences/lustre-diamant-en-carton-atelier-creation-upcycling/
  219. Lustre diamant en carton : atelier création upcycling
    https://yeswegreen.org/experiences/lustre-diamant-en-carton-atelier-creation-upcycling/
  220. No text
    https://yeswegreen.org/experiences/nettoyer-sa-maison-au-naturel-fabrication-de-produits-menagers/
  221. Nettoyer sa maison au naturel : Fabrication de produits ménagers
    https://yeswegreen.org/experiences/nettoyer-sa-maison-au-naturel-fabrication-de-produits-menagers/
  222. No text
    https://yeswegreen.org/experiences/soin-du-linge-fabrication-de-produits-menagers/
  223. Soin du linge : Fabrication de produits ménagers
    https://yeswegreen.org/experiences/soin-du-linge-fabrication-de-produits-menagers/
  224. No text
    https://yeswegreen.org/experiences/table-de-chevet-atelier-creation-dun-meuble-en-carton-upcycle/
  225. Table de chevet : atelier création d’un meuble en carton upcyclé
    https://yeswegreen.org/experiences/table-de-chevet-atelier-creation-dun-meuble-en-carton-upcycle/
  226. Biot4 Produits
    https://yeswegreen.org/categorie-produit/ville/biot/
  227. No text
    https://yeswegreen.org/categorie-produit/ville/biot/
  228. Bordeaux16 Produits
    https://yeswegreen.org/categorie-produit/ville/bordeaux/
  229. No text
    https://yeswegreen.org/categorie-produit/ville/bordeaux/
  230. Cannes2 Produits
    https://yeswegreen.org/categorie-produit/ville/cannes/
  231. No text
    https://yeswegreen.org/categorie-produit/ville/cannes/
  232. Lyon33 Produits
    https://yeswegreen.org/categorie-produit/ville/lyon/
  233. No text
    https://yeswegreen.org/categorie-produit/ville/lyon/
  234. Montpellier4 Produits
    https://yeswegreen.org/categorie-produit/ville/montpellier/
  235. No text
    https://yeswegreen.org/categorie-produit/ville/montpellier/
  236. Nantes2 Produits
    https://yeswegreen.org/categorie-produit/ville/nantes/
  237. No text
    https://yeswegreen.org/categorie-produit/ville/nantes/
  238. Paris127 Produits
    https://yeswegreen.org/categorie-produit/ville/paris/
  239. No text
    https://yeswegreen.org/categorie-produit/ville/paris/
  240. Reims2 Produits
    https://yeswegreen.org/categorie-produit/ville/reims/
  241. No text
    https://yeswegreen.org/categorie-produit/ville/reims/
  242. Toulouse2 Produits
    https://yeswegreen.org/categorie-produit/ville/toulouse/
  243. No text
    https://yeswegreen.org/categorie-produit/ville/toulouse/
  244. Histoire de YesWeGreen
    http://yeswegreen.org/a-propos-de-yeswegreen/
  245. L’équipe
    http://yeswegreen.org/lequipe-recherche-stage-ess/
  246. Nous rejoindre
    http://yeswegreen.org/nous-rejoindre/
  247. Formulaire de demande
    http://yeswegreen.org/formulaire-demande-groupe/
  248. Soumettre votre atelier/produit
    https://yeswegreen.org/host-an-experience/
  249. Ateliers
    http://yeswegreen.org/boutique/
  250. A domicile
    http://yeswegreen.org/categorie-produit/atelier/special-enfants/
  251. Produits green
    http://yeswegreen.org/boutique
  252. Ateliers enfants
    http://yeswegreen.org/categorie-produit/atelier/special-enfants/
  253. Cartes cadeaux
    http://yeswegreen.org/pass-cadeau/
  254. Offre entreprise
    http://yeswegreen.org/formulaire-demande-groupe/
  255. FAQ
    http://yeswegreen.org/faq/
  256. Lien
    https://yeswegreen.org/protection-donnees-personnelles/
  257. CGU / CGV
    http://yeswegreen.org/cgu/
  258. Protection des données personnelles
    http://yeswegreen.org/protection-donnees-personnelles/
  259. Mentions légales
    http://yeswegreen.org/mentions-legales/

Links - Internal (nofollow)

2:
  1. DÉCOUVREZ TOUS LES SECRETS DE SA CULTURE URBAINE
    https://yeswegreen.org/experiences/visite-ferme-urbaine-et-recolte-de-safran-repartez-avec-votre-dose-de-safran/
  2. EXPLOREZ NOS EXPÉRIENCES GREEN AU GRAND AIR
    https://yeswegreen.org/categorie-produit/atelier/nature/?products-per-page=all

Links - Outbound

3:
  1. Facebook
    https://www.facebook.com/yeswegreen
  2. Twitter
    https://twitter.com/@yeswegreen
  3. Instagram
    https://instagram.com/yeswegreen

Links - Outbound (nofollow)

0:

Keyword Cloud for Yeswegreen.org

tcallfiredtrackingzro dchetspourmnagersnote 500 sururlifeuro3500quick viewquieuro1500quickview abonnementsnaturelsgasendbeautvarduetyogadgustationlyon euro3000quick viewcuisinepartircosmtiquessur 5 euro2500quickaprospcialsafranabonnement annuel parisatelierexprienceeuro2500quick viewchezcarton ateliernaturellesoincessoinsproductslistannuel parisvar htmldivgreennosduncartondistance cuisinesatassinlademilune lyonannuellocal5 euro2500quickview distance8211 tassinlademilune lyonfabriquez vostracking by analytifynousfooddocumentcreateelementdiv htmldivinnerhtmleuro1900quick viewifhtmldivnous fabrication d8217unzrohuilefabrication d8217unsitelyon euro3000quickcosmtiques naturelsnos ateliersoudcheterravecces cookiessontfabrication de produitsproduits mnagersnote 500entrepriseeuro3500quickfalseweekendenglishnous fabriquez vosnous fabriquezhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0var htmldiv documentcreateelementdiv0htmldivcssproduits mnagersnoteuneelse var htmldivtassinlademilune lyon euro3000quickdeshtmldivcss elseateliers chezinitiationview food locavoretassinlademilunevins naturelsidhtmldivinnerhtml htmldivinnerhtml2distance distancelistnamehtmldiv documentcreateelementdivhtmldivinnerhtml htmldivcssview distance distancelyonleseuro600quick viewview ateliershtmldivinnerhtml htmldivinnerhtml htmldivcssatelier crationeuro1500quick viewncessairesvinsateliers sontelse varlocavorethisreadystatedocumentgetelementbyidrspluginsettingsinlinecss ifhtmldiv htmldivinnerhtmldocumentcreateelementdiv htmldivinnerhtml htmldivcsshtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0500 sur5 euro2500quick viewdansaudistance 8211vivreview ateliers chezeuro4000quick viewnotreerroreuro4500quick viewledchetsevent trackingdistance ateliermnagershtmldiv documentgetelementbyidrspluginsettingsinlinecss500 sur 5voschez vousabonnementdcouvrezview fooderr errmnagersnote 500jsvar htmldivcsseuro3000quickanalytifyhtmldiv documentcreateelementdiv htmldivinnerhtmlnous fabrication8211 fabricationkitet dgustationcateliers chez vousvoustousdistancehtmldivinnerhtml htmldivcss elsefunctioncosmtique8211 tassinlademiluneeuro3000quick view ateliersungaeventchez nousvous chezeuro1900quickundefinedifhtmldiv htmldivinnerhtmleuro4500quicksurenfantseuro4000quick view ateliersvotremozzarellahtmldivifhtmldiv htmldivinnerhtml htmldivinnerhtmlproduits mnagerspriceyeswegreenhtmldivcss else varclick1chez vous chezhtmldivinnerhtmldocumentgetelementbyidrspluginsettingsinlinecss ifhtmldivsur 5elsefabriquezeuro4000quickvous chez nousdistance distance ateliergasend eventvisageeuro1900quick view distancehtmldiv documentgetelementbyidrspluginsettingsinlinecss ifhtmldivvar htmldiv documentgetelementbyidrspluginsettingsinlinecssd8217unchez nous fabriquezcookiesdoneneeuro3000quick vieweuro600quickdocumentcreateelementdivnameproduitschez nous fabricationabonnementscrationviewcategorydistance distance 8211carton atelier crationparisateliersdans unefood locavoreurbainedans leeuro2500quicktruelabeldocumentgetelementbyidrspluginsettingsinlinecssvotre exprienceeuro600quick view distanceabonnement annuelzro dchetfabricationdocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0euro2500quick view ateliersmnagersnote3upcycling

Longtail Keyword Density for Yeswegreen.org

KeywordsOccurences
chez vous chez29
vous chez nous27
ateliers chez vous27
view ateliers chez27
view distance distance18
500 sur 57
view food locavore6
fabrication de produits6
distance distance atelier6
euro3000quick view ateliers5
chez nous fabrication5
distance distance 82115
euro4000quick view ateliers4
euro600quick view distance4
euro2500quick view ateliers4
5 euro2500quick view4
sur 5 euro2500quick4
mnagersnote 500 sur4
produits mnagersnote 5004
abonnement annuel paris4
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
tassin-la-demi-lune lyon euro3000quick3
nous fabriquez vos3
chez nous fabriquez3
carton atelier cration3
htmldiv documentgetelementbyidrs-plugin-settings-inline-css ifhtmldiv3
lyon euro3000quick view3
nous fabrication d8217un3
8211 tassin-la-demi-lune lyon3
documentgetelementbyidrs-plugin-settings-inline-css ifhtmldiv htmldivinnerhtml3
ifhtmldiv htmldivinnerhtml htmldivinnerhtml3
htmldivinnerhtml htmldivinnerhtml htmldivcss3
htmldivinnerhtml htmldivcss else3
htmldivcss else var3
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
else var htmldiv3
euro1900quick view distance3
var htmldiv documentcreateelementdiv3
htmldiv documentcreateelementdiv htmldivinnerhtml3
documentcreateelementdiv htmldivinnerhtml htmldivcss3
tracking by analytify3
chez vous32
vous chez29
ateliers chez28
chez nous28
view ateliers27
view distance20
distance distance18
atelier cration9
sur 58
500 sur7
food locavore7
euro3000quick view6
distance atelier6
euro2500quick view6
view food6
zro dchet6
var htmldiv6
htmldivinnerhtml htmldivcss6
vins naturels5
distance 82115
fabrication d8217un5
nous fabrication5
mnagersnote 5004
zro dchets4
ces cookies4
abonnement annuel4
euro600quick view4
euro4000quick view4
annuel paris4
produits mnagersnote4
5 euro2500quick4
view abonnements4
8211 tassin-la-demi-lune3
tassin-la-demi-lune lyon3
lyon euro3000quick3
carton atelier3
err err3
nous fabriquez3
euro3500quick view3
ateliers sont3
dans le3
votre exprience3
gasend event3
fabriquez vos3
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
nos ateliers3
documentgetelementbyidrs-plugin-settings-inline-css ifhtmldiv3
htmldiv documentcreateelementdiv3
else var3
distance cuisine3
htmldivcss else3
htmldivinnerhtml htmldivinnerhtml3
ifhtmldiv htmldivinnerhtml3
euro1500quick view3
euro1900quick view3
var htmldivcss3
produits mnagers3
et dgustation3
htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
8211 fabrication3
dans une3
documentcreateelementdiv htmldivinnerhtml3
euro4500quick view3
cosmtiques naturels3
event tracking3
chez64
view60
vous44
distance41
ateliers40
nous36
et31
atelier26
produits22
var20
sur16
fabrication16
les13
zro13
pour13
cookies12
012
au12
ou11
une11
le11
dans10
110
naturels10
paris9
cration9
d8217un9
htmldivcss9
htmldivinnerhtml9
err9
locavore8
votre8
function8
des8
dchet8
un7
27
vins7
food7
sont7
du6
cuisine6
kit6
green6
euro2500quick6
tcallfired6
euro3000quick6
vos6
dgustation6
else6
htmldiv6
ga6
exprience5
true5
cosmtiques5
yeswegreen5
if5
event5
site5
error5
lyon5
safran5
sa5
dchets4
false4
mnagersnote4
fabriquez4
label4
productslist4
ces4
listname4
tassin-la-demi-lune4
ncessaires4
carton4
euro4000quick4
notre4
yoga4
annuel4
soin4
abonnements4
abonnement4
mozzarella4
apro4
beaut4
enfants4
urbaine4
euro600quick4
nos4
huile4
soins4
undefined4
dcouvrez4
33
c3
tous3
js3
gasend3
euro1900quick3
ne3
vivre3
id3
name3
category3
price3
tracking3
analytify3
url3
local3
thisreadystate3
documentcreateelementdiv3
dun3
euro3500quick3
euro1500quick3
initiation3
visage3
qui3
english3
cosmtique3
euro4500quick3
partir3
avec3
week-end3
upcycling3
spcial3
naturelle3
entreprise3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
mnagers3
ifhtmldiv3
documentgetelementbyidrs-plugin-settings-inline-css3
done3
click3

Yeswegreen.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Yeswegreen.org is a scam?

Websites with Similar Names

Yeswe-art.com
Yes We Art – Graphic Design & Portfolio
Yeswe.online
yeswe.online - Registered at Namecheap.com
Yeswead.com
:: YesWeAd ::
Yesweadate.xyz
The Meet Up
Yesweadvice.com
Access denied | yesweadvice.com used Cloudflare to restrict access
Yesweafrican.com
Yes We AfriCan
Yeswear.com
yeswear.com
Yeswearelatinos.com
Yes! We are Latinos | Teachers' Resources Website
Yeswearemad.com
Yes We Are Mad

Recently Updated Websites

Golfinggo.com 1 second ago.Unlicensedcontractorsolutions.com 2 seconds ago.Arribamexicangrill.com 2 seconds ago.Autosung.com 2 seconds ago.Zimlanguages.com 3 seconds ago.Shirleyandchris.net 3 seconds ago.Grontmiljo.dk 3 seconds ago.Villaserenitycuracao.com 4 seconds ago.Avnibatra.in 5 seconds ago.Blindguardianturkiye.com 5 seconds ago.Zhierming.com 6 seconds ago.Thecarryons.com 6 seconds ago.Fwonk.co.uk 6 seconds ago.Thesacredsale.net 7 seconds ago.Michiganlp.org 7 seconds ago.Arizonapestprevention.com 7 seconds ago.Abcplayers.org 7 seconds ago.Coolmature.net 8 seconds ago.Ksddesign.com 8 seconds ago.Ibizapersonaltraining.com 8 seconds ago.Discoverldi.com 8 seconds ago.Rajekwesi.ac.id 9 seconds ago.Crystalspringsmining.com 9 seconds ago.Eltatuaje.com 9 seconds ago.Bjgyrz.com 9 seconds ago.Hao08.net 10 seconds ago.Mecanique-grem.com 10 seconds ago.Raine-loire.com 11 seconds ago.Hamptonscareers.com 11 seconds ago.Mikan-editions.com 11 seconds ago.