Kullan?c? Yorumlar? | Yorumlariniz.net

Safety: Low trust score
Year Founded: 2013
Global Traffic Rank: Unknown
Estimated Worth: $9,360
Last updated:2015-09-02

Ürün kullan?c? yorumlar? ürünleri kullananlar incelemeleri yorumlar? hizmetler hakk?nda tavsiye öneri ?ikayetler ürün fiyat inceleme özellikleri


Domain summary

Domain label
yorumlariniz
Domain extension
net
Domain registered:
2013-01-22
Domain updated:
2015-08-15
Domain expires:
2018-01-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9,360
Estimated daily income
$26
Estimated monthly income
$791

Rank summary

How is yorumlariniz.net ranked relative to other sites:

Percentage of visits to yorumlariniz.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Yorumlariniz.net registered?
A: Yorumlariniz.net was registered 8 years, 1 month, 1 week, 3 days, 9 hours, 47 minutes, 40 seconds ago on Tuesday, January 22, 2013.
Q: When was the WHOIS for Yorumlariniz.net last updated?
A: The WHOIS entry was last updated 5 years, 6 months, 2 weeks, 3 days, 9 hours, 47 minutes, 40 seconds ago on Saturday, August 15, 2015.
Q: What are Yorumlariniz.net's nameservers?
A: DNS for Yorumlariniz.net is provided by the following nameservers:
  • ns1.guzelhosting.com
  • ns11.guzelhosting.com
  • ns12.guzelhosting.com
  • ns2.guzelhosting.com
Q: Who is the registrar for the Yorumlariniz.net domain?
A: The domain has been registered at .
Q: What is the traffic rank for Yorumlariniz.net?
A: Yorumlariniz.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Yorumlariniz.net each day?
A: Yorumlariniz.net receives approximately 2,116 visitors and 8,541 page impressions per day.
Q: What IP address does Yorumlariniz.net resolve to?
A: Yorumlariniz.net resolves to the IPv4 address 185.106.210.203.
Q: In what country are Yorumlariniz.net servers located in?
A: Yorumlariniz.net has servers located in the Turkey.
Q: What webserver software does Yorumlariniz.net use?
A: Yorumlariniz.net is powered by webserver.
Q: Who hosts Yorumlariniz.net?
A: Yorumlariniz.net is hosted by Netinternet Bilgisayar ve Telekomunikasyon San. ve Tic. Ltd. Sti. in Turkey.
Q: How much is Yorumlariniz.net worth?
A: Yorumlariniz.net has an estimated worth of $9,360. An average daily income of approximately $26, which is roughly $791 per month.

Yorumlariniz.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yorumlariniz.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yorumlariniz.net

H1 Headings

1 :
  1. 0

H2 Headings

1 :
  1. 22

H3 Headings

1 :
  1. 7

H4 Headings

1 :
  1. 11

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

0 :

Total Images

41 :

Google Adsense

:
pub-1722007716358682

Google Analytics

:
UA-57203576-1

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Who hosts Yorumlariniz.net?

Yorumlariniz.net Hosting Provider Information

Hosted IP Address:185.106.210.203
Hosted Hostname:203awk1xu.guzel.net.tr
Service Provider:Netinternet Bilgisayar ve Telekomunikasyon San. ve Tic. Ltd. Sti.
Hosted Country:TurkeyTR
Location Latitude:41.0214
Location Longitude:28.9948
Webserver Software:Not Applicable

Is "Netinternet Bilgisayar ve Telekomunikasyon San. ve Tic. Ltd. Sti." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
%

HTTP Header Analysis for Yorumlariniz.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.5.28
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://yorumlariniz.net/xmlrpc.php
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
Date: Wed, 02 Sep 2015 06:16:20 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close

Yorumlariniz.net Domain Nameserver Information

HostIP AddressCountry
ns1.guzelhosting.com 31.192.212.5
ns11.guzelhosting.com 198.211.96.32
ns12.guzelhosting.com 149.202.246.70
ns2.guzelhosting.com 64.227.75.252


Need to find out who hosts Yorumlariniz.net?


Domain Registration (WhoIs) information for Yorumlariniz.net

 Domain Name: YORUMLARINIZ.NET
Registry Domain ID: 1775341418_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2015-08-15T08:53:49Z
Creation Date: 2013-01-22T14:53:39Z
Registry Expiry Date: 2018-01-22T14:53:39Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.GUZELHOSTING.COM
Name Server: NS11.GUZELHOSTING.COM
Name Server: NS12.GUZELHOSTING.COM
Name Server: NS2.GUZELHOSTING.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-10T12:36:39Z

Websites with Similar Names

Yorum-haber.com
Yorum Haber | Bursa
Yorum-online.de
Yorum Online
Yorum-tarih.com
WordPress › Hata
Yorum-turkiye.com
http://yorum-turkiye.com/ — ??? ???? ???? ?? WordPress
Yorum.club
yorumclub – şimdi yorum sırası bizde
Yorum.store
Database Error
Yorum32.com
yorum32.com | Isimtescil.net | Ücretsiz yap?m a?amas?nda sayfas?
Yorum34.com
yorum34.com | Ücretsiz yapım aşamasında sayfası
Yorum34.xyz
yorum34.xyz | Ücretsiz yapım aşamasında sayfası

Recently Updated Websites

Apppax.us (6 seconds ago.)Gardenoakssylvania.com (6 seconds ago.)Beardsalute.com (8 seconds ago.)Herpropertyservices.com (8 seconds ago.)Mercedes-schweighouse.com (16 seconds ago.)Pueblagrillmenu.com (17 seconds ago.)Webdeveloperdepot.com (17 seconds ago.)Qrriculum.org (19 seconds ago.)Californiatimes.us (21 seconds ago.)Pivotpanel.com (22 seconds ago.)Dupimentdansmonlit.com (22 seconds ago.)Nmedia.systems (24 seconds ago.)Shopgingershots.net (24 seconds ago.)Arabiascreen.com (26 seconds ago.)Handi-zone.net (27 seconds ago.)Trendingpsychology.com (27 seconds ago.)Cc-cake.com (29 seconds ago.)Cargocollege.com (31 seconds ago.)Jazzypocket.com (32 seconds ago.)Angadkumar.com (33 seconds ago.)Permis-dijon.org (35 seconds ago.)Legalgantt.org (38 seconds ago.)Kickandconnect.com (38 seconds ago.)Cheap-face-mask.com (40 seconds ago.)Persistrealty.com (41 seconds ago.)Revenest.com (42 seconds ago.)Playspectro.com (43 seconds ago.)Metroblueline.net (45 seconds ago.)Donostisalvaescaleras.com (46 seconds ago.)Barfuss-leguano.de (46 seconds ago.)

Recently Searched Keywords

ls17 update (1 second ago.)356hk (1 second ago.)vi mc gi (6 seconds ago.)big cash download (7 seconds ago.)0900 (9 seconds ago.)viruses amp (10 seconds ago.)_k_______ (11 seconds ago.)ecom- aic (13 seconds ago.)cá kho làng vũ đại thương hiệu dasavina đạt danh hiệu vàng – món ngon tinh hoa ẩm thực việt 2014 (21 seconds ago.)vi mc (22 seconds ago.)nikolaus knebel oman (23 seconds ago.)ip (23 seconds ago.)wood pictures (26 seconds ago.)glamming (27 seconds ago.)gas — с чего начать изучение (28 seconds ago.)importantborder0px (29 seconds ago.)hoursavailable type openinghoursspecification (29 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (34 seconds ago.)0 v8 (36 seconds ago.)vi khch hng (42 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (57 seconds ago.)0 ii (58 seconds ago.)marketing business intelligence (1 minute 3 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (1 minute 23 seconds ago.)enim ipsam voluptatem (1 minute 24 seconds ago.)0 24 (1 minute 26 seconds ago.)《光明日报》报道青年农机专家王东伟致力花生机械装备研发 (1 minute 35 seconds ago.)808217li (1 minute 39 seconds ago.)holy quran in urdu (1 minute 43 seconds ago.)-x-x (1 minute 46 seconds ago.)