Home | Yeshiva University

Safety: Low trust score
Year Founded: 1987
Global Traffic Rank: 10,761
Estimated Worth: $1,413,360



Domain summary

Last updated
2021-08-12
Domain label
yu
Domain extension
edu
Domain registered:
1987-04-04
Domain updated:
2021-07-20
Global Traffic Rank
10,761
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$1,413,360
Estimated daily income
$1,963
Estimated monthly income
$59,708

Frequently Asked Questions (FAQ)

Q: When was Yu.edu registered?
A: Yu.edu was registered 34 years, 8 months, 1 day, 7 hours, 4 minutes, 27 seconds ago on Saturday, April 4, 1987.
Q: When was the WHOIS for Yu.edu last updated?
A: The WHOIS entry was last updated 4 months, 2 weeks, 2 days, 7 hours, 4 minutes, 27 seconds ago on Tuesday, July 20, 2021.
Q: What are Yu.edu's nameservers?
A: DNS for Yu.edu is provided by the following nameservers:
  • ns1.yu.edu
  • ns2.yu.edu
  • dns03.nysernet.org
Q: Who is the registrar for the Yu.edu domain?
A: The domain has been registered at EDUCASE.
Q: What is the traffic rank for Yu.edu?
A: Yu.edu ranks 10,761 globally on Alexa. Yu.edu has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Yu.edu each day?
A: Yu.edu receives approximately 163,554 visitors and 981,324 page impressions per day.
Q: What IP address does Yu.edu resolve to?
A: Yu.edu resolves to the IPv4 address 23.185.0.2.
Q: In what country are Yu.edu servers located in?
A: Yu.edu has servers located in the United States.
Q: What webserver software does Yu.edu use?
A: Yu.edu is powered by Nginx webserver.
Q: Who hosts Yu.edu?
A: Yu.edu is hosted by OJSC Vimpelcom in United States.
Q: How much is Yu.edu worth?
A: Yu.edu has an estimated worth of $1,413,360. An average daily income of approximately $1,963, which is roughly $59,708 per month.

Yu.edu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yu.edu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yu.edu

H1 Headings

8 :
  1. Orientation
  2. Earn an Occupational Therapy Doctorate (OTD)
  3. Earn Your Master's in Real Estate
  4. Earn your M.S. in Jewish Education from Azrieli
  5. Orientation
  6. Earn an Occupational Therapy Doctorate (OTD)
  7. Earn Your Master's in Real Estate
  8. Earn your M.S. in Jewish Education from Azrieli

H2 Headings

2 :
  1. Search
  2. YU Events

H3 Headings

1 :
  1. {{title}}

H4 Headings

1 :
  1. Message From Our President

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

189:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yu.edu

programinternational studentsmain contentsephardicmainjewish living ampyork citylearnjewish livinggraduateschool of jewishu003cbuttoneachexperiencefacultyamp learningeventsinfoclassu0022eucookiecompliancemessageu0022u003enschoolswe havebypassmenuclassu0022eucookiecompliancebuttonsu0022u003enpleaseclassu0022eucookiecompliancebuttonsu0022u003en u003cbuttonfour featuredvisitstudentsu003cdiv classu0022popupcontent infofirstu003cdiv classu0022popupcontentimpactpagechangenew york cityclassu0022popupcontent infoinfo eucookiecompliancecontentu0022u003enourclassu0022eucookiecompliancebuttonsu0022u003en u003cbutton typeu0022buttonu0022u003cdiv idu0022popuptextu0022searchhaveyuu003cdivu003enwebsitesupportcontacteucookiecompliancecontentu0022u003en u003cdiv idu0022popuptextu0022lifeampgofall semesteracademicu003cdiv idu0022popupbuttonsu0022utilityhome pageschooltoprealundergraduatestaffservicesinternationallessonsskipuniversityotheryeshiva universityfourdonorjewishalsoidu0022popuptextu0022 classu0022eucookiecompliancemessageu0022u003ensywomen039su003cdivu003en u003cdiv idu0022popupbuttonsu0022applicantscampusesprogramscontentsectioncookiesacademicscitynewsfallmanydescriptionlivingnewreadtimemoreduringfuturethroughyorkbutsymshomeeucookiecompliancecontentu0022u003en u003cdivmain navigationinfo eucookiecompliancecontentu0022u003en u003cdivlinkslikegiveupplansleadersliving ampcampusplanningcareertaskour studentsyourtorahadmissionseucookiecompliancecontentu0022u003enmen039syeshivawemomentidu0022popupbuttonsu0022guidetypeu0022buttonu0022theirkatzsemesteru003cdivreal estatenew yorku003cdiv idu0022popupbuttonsu0022 classu0022eucookiecompliancebuttonsu0022u003entorah studiesnextyouu003cdiv idu0022popuptextu0022 classu0022eucookiecompliancemessageu0022u003enisraelstudiesforcenavigationsupport yunavigation to bypassfriendsestateadministrationsy symsclassu0022popupcontentupdatescommunityidu0022popupbuttonsu0022 classu0022eucookiecompliancebuttonsu0022u003en u003cbuttonbackuselearn moreu003cdivu003en u003cdivacademics undergraduatestudentlearningu003cbutton typeu0022buttonu0022earntask forcejewish futurehasclassu0022popupcontent info eucookiecompliancecontentu0022u003enlinkidu0022popuptextu0022undergraduate admissionsidu0022popupbuttonsu0022 classu0022eucookiecompliancebuttonsu0022u003enskip linkyeargraduate schoolliving amp learningcenternotusamalumnihealthworkorientationinformationcollegefeaturedseminaryskip to maingiftsonlinedifferently

Longtail Keyword Density for Yu.edu

KeywordsOccurences
new york city4
skip to main4
navigation to bypass3
jewish living amp3
living amp learning3
school of jewish3
u003cdiv classu0022popup-content info3
classu0022popup-content info eu-cookie-compliance-contentu0022u003en3
info eu-cookie-compliance-contentu0022u003en u003cdiv3
eu-cookie-compliance-contentu0022u003en u003cdiv idu0022popup-textu00223
u003cdiv idu0022popup-textu0022 classu0022eu-cookie-compliance-messageu0022u003en3
u003cdivu003en u003cdiv idu0022popup-buttonsu00223
u003cdiv idu0022popup-buttonsu0022 classu0022eu-cookie-compliance-buttonsu0022u003en3
idu0022popup-buttonsu0022 classu0022eu-cookie-compliance-buttonsu0022u003en u003cbutton3
classu0022eu-cookie-compliance-buttonsu0022u003en u003cbutton typeu0022buttonu00223
yeshiva university10
our students7
torah studies6
u003cbutton typeu0022buttonu00225
main navigation5
new york5
graduate school4
academics undergraduate4
fall semester4
york city4
we have4
four featured3
real estate3
classu0022eu-cookie-compliance-buttonsu0022u003en u003cbutton3
idu0022popup-buttonsu0022 classu0022eu-cookie-compliance-buttonsu0022u003en3
u003cdiv idu0022popup-buttonsu00223
u003cdivu003en u003cdiv3
idu0022popup-textu0022 classu0022eu-cookie-compliance-messageu0022u003en3
u003cdiv idu0022popup-textu00223
eu-cookie-compliance-contentu0022u003en u003cdiv3
info eu-cookie-compliance-contentu0022u003en3
classu0022popup-content info3
u003cdiv classu0022popup-content3
international students3
learn more3
skip link3
jewish future3
task force3
home page3
support yu3
amp learning3
living amp3
jewish living3
undergraduate admissions3
main content3
sy syms3
our42
students18
studies17
yu16
graduate15
we15
navigation14
jewish14
center13
university13
school12
yeshiva12
student11
amp10
skip10
more10
online10
page10
campus9
main9
u003cdiv9
faculty9
your9
programs9
events8
program8
semester8
undergraduate8
israel8
admissions8
fall7
torah7
news7
new7
have7
life7
next7
section7
services6
future6
you6
typeu0022buttonu00226
use6
u003cdivu003en6
applicants6
college5
us5
u003cbutton5
each5
links5
york5
support5
info5
academic5
search5
international5
utility4
menu4
but4
cookies4
donor4
top4
home4
schools4
academics4
living4
learn4
city4
health4
their4
has4
experience4
back4
content4
learning4
campuses4
planning4
community4
work4
website4
please4
impact3
sephardic3
through3
during3
classu0022eu-cookie-compliance-buttonsu0022u003en3
idu0022popup-buttonsu00223
visit3
like3
career3
orientation3
give3
year3
gifts3
differently3
earn3
real3
task3
moment3
other3
leaders3
classu0022popup-content3
eu-cookie-compliance-contentu0022u003en3
idu0022popup-textu00223
classu0022eu-cookie-compliance-messageu0022u003en3
estate3
lessons3
women039s3
also3
plans3
description3
go3
read3
updates3
guide3
contact3
change3
four3
featured3
first3
not3
link3
bypass3
men039s3
many3
am3
information3
friends3
alumni3
administration3
katz3
staff3
sy3
time3
up3
seminary3
force3
syms3

Who hosts Yu.edu?

Yu.edu Hosting Provider Information

Hosted IP Address:23.185.0.2
Hosted Hostname:23.185.0.2
Service Provider:OJSC Vimpelcom
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "OJSC Vimpelcom" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
OJSC Vimpelcom
0.0159%

HTTP Header Analysis for Yu.edu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Length: 24498
Cache-Control: max-age=3600, public
Content-Encoding: gzip
Content-Language: en
Content-Type: text/html; charset=UTF-8
Etag: W/"1628712866"
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Wed, 11 Aug 2021 20:14:26 GMT
Link:; rel="revision"
Server: nginx
X-Content-Type-Options: nosniff
X-Drupal-Cache: HIT
X-Drupal-Dynamic-Cache: MISS
X-Frame-Options: SAMEORIGIN
X-Generator: Drupal 8 (https://www.drupal.org)
X-Pantheon-Styx-Hostname: styx-fe2-a-647564f48c-2v47h
X-Styx-Req-Id: 566a35d6-fb2c-11eb-9333-92bc9f214d2b
X-Ua-Compatible: IE=edge
Date: Thu, 12 Aug 2021 15:37:11 GMT
X-Served-By: cache-mdw17353-MDW, cache-lon4246-LON
X-Cache: HIT, HIT
X-Cache-Hits: 1, 1
X-Timer: S1628782631.142567,VS0,VE89
Pantheon-Trace-Id: 0518b3a840774dfba6f93cac2b8f473d
Vary: Accept-Encoding, Cookie, Cookie, Cookie
Age: 992
Accept-Ranges: bytes
Via: 1.1 varnish, 1.1 varnish

Yu.edu Domain Nameserver Information

HostIP AddressCountry
ns1.yu.edu 129.98.112.4United States United States
ns2.yu.edu 129.98.180.4United States United States
dns03.nysernet.org 199.109.17.130United States United States


Need to find out who hosts Yu.edu?


Domain Registration (WhoIs) information for Yu.edu

 This Registry database contains ONLY .EDU domains.
The data in the EDUCAUSE Whois database is provided
by EDUCAUSE for information purposes in order to
assist in the process of obtaining information about
or related to .edu domain registration records.

The EDUCAUSE Whois database is authoritative for the
.EDU domain.

A Web interface for the .EDU EDUCAUSE Whois Server is
available at: http://whois.educause.edu

By submitting a Whois query, you agree that this information
will not be used to allow, enable, or otherwise support
the transmission of unsolicited commercial advertising or
solicitations via e-mail. The use of electronic processes to
harvest information from this server is generally prohibited
except as reasonably necessary to register or modify .edu
domain names.

-------------------------------------------------------------

Domain Name: YU.EDU

Registrant:
Yeshiva University
Information Technology Services
2495 Amsterdam Ave, Belfer Hall room 611
New York, NY 10033
USA

Administrative Contact:
Domain Admin
Yeshiva University
Information Technology Services
2495 Amsterdam Ave, Belfer Hall room 611
New York, NY Login to show email
Contact:

Yeshiva University
Information Technology Services
2495 Amsterdam Ave, Belfer Hall room 611
New York, NY Login to show email
Servers:
DNS03.NYSERNET.ORG
NS1.YU.EDU
NS2.YU.EDU

Domain record activated: 04-Apr-1987
Domain record last updated: 20-Jul-2021
Domain expires: 31-Jul-2024

Websites with Similar Names

Yu-1.com
403 Forbidden
Yu-11blog.com
403 Forbidden
Yu-2020.com
ゆうパパログ | 新米パパのブログ
Yu-22s.com
HEALING

Recently Updated Websites

Kochkurse-online.info (3 seconds ago.)Rosskoeberl.online (7 seconds ago.)Auctiondirectbuyingcenter.com (9 seconds ago.)Annhaberstanton.com (17 seconds ago.)Hartmerch.com (18 seconds ago.)Meconomics.net (18 seconds ago.)Delta-motors.be (20 seconds ago.)Midnightattheoasis.net (21 seconds ago.)Happymondays.co.uk (24 seconds ago.)Mueblesamuedo.com (25 seconds ago.)Yati137.app (29 seconds ago.)Varsitynewspaper.co.za (30 seconds ago.)Asemindia.com (32 seconds ago.)Magrek.com (33 seconds ago.)Attorneymyrtlebeachsc.com (34 seconds ago.)Ambatohoy.com (36 seconds ago.)Classicnike.com (41 seconds ago.)Vetwebcams.com (43 seconds ago.)Newtestfestival.com (44 seconds ago.)Moto-baza.com (44 seconds ago.)Thinkingoutloud.com (44 seconds ago.)Heatpress.net (46 seconds ago.)Yaqi2450.vip (48 seconds ago.)Loiretconceptauto.com (53 seconds ago.)Myleasia.com (54 seconds ago.)Oravamedia.net (56 seconds ago.)Kgsupplies.com (58 seconds ago.)Premiertransporte.com (59 seconds ago.)Souvigny.com (1 minute 1 second ago.)Chargingstationonwheels.com (1 minute 3 seconds ago.)

Recently Searched Keywords

tlc (1 second ago.)变形金刚 (1 second ago.)imgwidthauto (3 seconds ago.)37 1bordersolid (4 seconds ago.)etbloomoptin10 etbloomformcontainer (5 seconds ago.)whispering acres (6 seconds ago.)txtv100 (6 seconds ago.)maicon al nassr transfermarkt (6 seconds ago.)nicolette shea brazzers (6 seconds ago.)trng khng th (6 seconds ago.)maicon al nassr transfermarkt (6 seconds ago.)soin sans rinçage et démêlant (7 seconds ago.)12 600 руб в евро (7 seconds ago.)akturt (8 seconds ago.)mayurbhanj admin twitter (8 seconds ago.)txtv100 (9 seconds ago.)log in to sappartneredge.com (9 seconds ago.)highland oaks at water run (10 seconds ago.)panier 0 (13 seconds ago.)panier 0 linge (13 seconds ago.)hack panier 0 acnl (13 seconds ago.)частный займ от инвестора до 700 000 рублей под расписку (15 seconds ago.)panier 0 bois (15 seconds ago.)eseménynaptár (15 seconds ago.)迷你裙下的春光[10p] (17 seconds ago.)nude beach female back and front pussy close-up (17 seconds ago.)частный займ от инвестора до 700 000 рублей под расписку (17 seconds ago.)panier 0 linge ikea (18 seconds ago.)panier 0 acnl (18 seconds ago.)na běhání (19 seconds ago.)