YUTA Turističke agencije | Leto 2021, Grcka, Turska Leto 2021, putovanja, Srbija

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 658,081
Estimated Worth: $9
Category: Travel

Turističke agencije YUTA - Nacionalna asocijacija turističkih agencija Srbije, Letovanje 2021, putovanja, Grčka 2021 apartmani



Domain summary

Last updated
2020-10-25
Domain label
yuta
Domain extension
rs
Global Traffic Rank
658,081
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Yuta.rs registered?
A: Yuta.rs was registered 11 months, 4 days, 2 hours, 10 minutes, 19 seconds ago on Sunday, October 25, 2020.
Q: When was the WHOIS for Yuta.rs last updated?
A: The WHOIS entry was last updated 11 months, 4 days, 2 hours, 10 minutes, 19 seconds ago on Sunday, October 25, 2020.
Q: What are Yuta.rs's nameservers?
A: DNS for Yuta.rs is provided by the following nameservers:
  • dns1.orion.rs
  • dns2.orion.rs
  • dns4.orion.rs
  • dns3.orion.rs
Q: Who is the registrar for the Yuta.rs domain?
A: The domain has been registered at .
Q: What is the traffic rank for Yuta.rs?
A: Yuta.rs ranks 658,081 globally on Alexa. Yuta.rs has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Yuta.rs each day?
A: Yuta.rs receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Yuta.rs resolve to?
A: Yuta.rs resolves to the IPv4 address 77.105.37.82.
Q: In what country are Yuta.rs servers located in?
A: Yuta.rs has servers located in the Serbia.
Q: What webserver software does Yuta.rs use?
A: Yuta.rs is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Yuta.rs?
A: Yuta.rs is hosted by Drustvo za telekomunikacije Orion telekom doo Beograd, Gandijeva 76a in Serbia.
Q: How much is Yuta.rs worth?
A: Yuta.rs has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Yuta.rs Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yuta.rs Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Yuta.rs

H1 Headings

2 :
  1. YUTA
  2. TOP DESTINACIJE

H2 Headings

5 :
  1. Ponude Yuta članica
  2. Yuta članice po slučajnom izboru
  3. YUTA
  4. Izdvajamo
  5. Mailing Lista

H3 Headings

4 :
  1. Prednosti članstva
  2. Izdvajamo iz ponude naših članica
  3. YUTA - Najnovije vesti
  4. YUTA - Anketa

H4 Headings

42 :
  1. Pretraga putovanja po?
  2. Pretražite YUTA članice
  3. First minute ponude agencija
  4. Last minute ponude agencija
  5. YUTAO nama
  6. POVERENJEZadovoljstvo i zaštita putnika
  7. ČLANSTVOPostanite član
  8. EDUKACIJARazvojno edukativni centar
  9. RECPRESS Centar YUTA
  10. Informisanje
  11. Podaci
  12. Saveti
  13. Edukacija
  14. Upravljanje
  15. Podsticajna sredstva
  16. Kontakti
  17. Regionalno poslovanje
  18. Ušteda
  19. Povezanost
  20. YUTA Garancija putovanja
  21. Letovanje (broj ponuda: 1467)
  22. Evropski gradovi (broj ponuda: 45)
  23. Prolećna putovanja (broj ponuda: 2)
  24. Side(Broj ponuda: 180)
  25. Alanja(Broj ponuda: 179)
  26. Krf(Broj ponuda: 112)
  27. Kemer(Broj ponuda: 97)
  28. Belek(Broj ponuda: 71)
  29. Bansko(Broj ponuda: 64)
  30. Kušadasi(Broj ponuda: 62)
  31. Krit(Broj ponuda: 40)
  32. Lara(Broj ponuda: 33)
  33. Tasos(Broj ponuda: 30)
  34. Aja Napa(Broj ponuda: 27)
  35. Rodos(Broj ponuda: 26)
  36. Produžena zabrana ulaska stranih državljana u Grčku do 30 09 2020
  37. Građani Srbije mogu da putuju u Bugarsku bez PCR testa
  38. Režim ulaska državljana Republike Srbije u AR Egipat od 01 09 2020
  39. Costa Diadema - Februarsko krstarenje Emirati, Oman, Katar
  40. Rim 2 noćenja
  41. Avio karte Beograd Tivat
  42. OHRID I STRUGA LETO 2020 SEVERNA MAKEDONIJA

H5 Headings

16 :
  1. Toskana sa obilascima Firence - Pize - Luke - Siene - San Điminjana
  2. Leto Grčka - Skiatos
  3. IZLET U PEČUJ
  4. Drakula tura
  5. Dominikana - individualna putovanja
  6. Kongresi iz oblasti medicine
  7. SKIJANJE BUGARSKA BANSKO
  8. Budimpešta
  9. KRSTARENJE DRINOM 2020 - VIKEND
  10. Da li na letovanje putujete sa agencijom ili u sopstvenom aranžmanu:
  11. Letovaćete u?
  12. Države
  13. Tip putovanja
  14. Destinacije
  15. YUTA Garancija putovanja
  16. Katalozi putovanja

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

104 :

Google Adsense

:
pub-2195736547765674

Google Analytics

:
UA-121356342-1

Links - Internal

128:

Links - Internal (nofollow)

0:

Links - Outbound

27:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yuta.rs

minutedelatnostid ddldelatnostidvalseniora yutafunction idddlppsmestajemptyddlppagencijeval vareachdatakat function idalmaoptionid ddllastminagencijeappend eachdatakat functionturskaddlppuslugeparentchildrencustomselecttext ifvar ddlstateswellnesseachdataagencije function iddelatnosteachdatasmestaj functionurlsubstring0 urllengthtype get urlavioddlppdrzaveempty ddlppagencijeempty ddlppdestinacijaappendsmestajidddlpptipappendnew optionoptionnamevar smestaj ddlppsmestajparentchildrencustomselecttextupravna i radnaizaberite agencijusearchloadddlagencijeddlppsmestajappendnew optionoptionname optionidretrieve dataddlppdestinacijaempty ddlppdrzaveempty ddlppagencijeemptyusl uslreplacesgdanadest destreplacesgeachdatadestilinoi vrste prevozaeachdatadest functionsatouristtipid tipidtravel amp1 previndexofizaberirbpretragaagencijaischecked ddlppdestinacijaemptylastif smestajindexofizaberiddllastmindrzaveizaberi drzavu option ddlppagencijeappendnew optionoptionnameurl smestaj varo namaagen varprevindexofizaberiprevozid ddlppprevozval vareachdataagencijeelse if rbpretragaagencijaischeckedtrue else ddlppdrzaveappendnewurl urlizaberi agen eachdataagencijesmestajid smestajid uslugaidfunctionprevreplacesg tolowercaseputovanjausl ddlppuslugeparentchildrencustomselecttextoptionoptionnamedelatnostidselecteditem katidkategorijaidrbpretragatipischecked ddlppdestinacijaemptyeachdataprev function iderror function xhroptionid ddlppsmestajappenduslindexofizaberi 1option ddlppprevozappendnew optionoptionnameagenindexofizaberismestaj italijapousl uslreplacesg tolowercaseoptionid ddlppuslugeappend izaberiselecteditem katid kategorijaidddlppdrzaveappendagenindexofizaberi 1ddlppdestinacijaval var drzidfunction data ifwindowlocationhrefizaberi destddldelatnostidval varyuta oddllastmintipval varzdravstveniuslreplacesgelse ddlppdrzaveappendnew optionoptionnamerbpretragadestischeckedagenidvar uslugeid ddlppuslugevaloptionselectedtextreplacesg tolowercasemegalos travel agencyturistikih agencija srbijeplaninski turizamvar agenddlppdestinacijavalletovanjeif rbpretragadestischeckedstrhotelurl agenddlpptipappend1 prev prevreplacesglanstvaoptionselectedtextreplacesg tolowercase urlthisval varif predrzvar urlrbpretragadestischecked ddlpptipemptyoptionid ddlppagencijeempty ddlppagencijeappendvar drzid3holidayes traveltravel amp serviceddlppuslugeval varget url searchloadddlagencijeurl searchloadddlagencijeoption ddlppuslugeappendnewselecteditemizaberi agenciju optionid elseagencijaid ddlppagencijevalddlppprevozpropdisabled trueajax cachetip eachdatakatmestoid ddlmestoidvaloption ddlppuslugeappendnew optionoptionnameagenid agencijaid prevozidddlppuslugeappendnew optionoptionnameyutaddlppprevozval varurlsubstring0id option ddlppprevozappendnewgarancija putovanjaddlagnappendnewvar regionidagencijaid prevozid1 smestaj smestajreplacesgoptionoptionname optionid ddlppuslugeappendregionidminprev prevreplacesg tolowercaseklub seniora yutalanicatolowercaseurl prevusl ddlppuslugeparentchildrencustomselecttext ifid option ddlppdrzaveappendnewkategorijaid ddllastmintipval varddlppprevozappend izaberi prevozddlppprevozvalsearchloadddlagencije data regioniddrzindexofizaberi 1urlendswith1 smestajvar tipidurl url drzpostatiedukativni centarpredestelnos toursmontesol travelvarcountddlppagencijeempty ddlppagencijeappend izaberieachdatauslugeoptionid ddlppprevozappendthrownerrorstatesprogresshide kartestartbanjski turizamddlppdrzaveappend izaberi eachdatasmestaj functionerrorddlppsmestajval var uslugeidif predrz optionidif regionidoption ddlppdestinacijaappendnew optionoptionnameenableallprevreplacesgvar smestajid ddlppsmestajvalddlppagencijeval var prevoziddestreplacesg tolowercase urlmegalos travelgradovilaniceif urlendswith urlddlppprevozpropdisabled0grkaif uslindexofizaberi 1url searchloadddlagencije datafirstddlpptipemptyprevozid prevozid smestajidstatesprogressshowmediteraneo holidaysuslugaid uslugeid successoption ddlppsmestajappendnew optionoptionnameddlstatesappendnewsearchloadddlppsmestajpropdisabled true ddlppuslugepropdisabledsmestaj smestajreplacesgfnrbdestddlppsmestajappend izaberi smestajizaberi drzavuizaberi prevozevropskitravelddlfirstmintipvalvar prevddlppdrzaveappend izaberi drzavuuslugeid ddlppuslugeval varvar mestoidvar prev ddlppprevozparentchildrencustomselecttextddlstatesappendnew optionoptionname1 smestajindexofizaberi021statesprogressshow ajax cachevestioption ddlpptipappendnewoptionoptionname optionid truerbpretragaagencijaischecked ddlppdestinacijaempty ddlppdrzaveemptygrand toursurl url smestajddlppprevozparentchildrencustomselecttext if1 uslindexofizaberi 1prev prevreplacesgddlpptipval vareachdatadrzave functionurl urlsubstring0optionoptionname optionid ifevropski gradovioption ddlppdestinacijaappendnewddllastmindrzave varif destindexofizaberi 1rbpretragatipischeckedeachdataprev functionmestoidkontakteachdatadrzavetip ddllastminagencijeappend izaberilast minute putovanjapredest optionid ddlppdestinacijaappendnewerror functionddlppagencijepropdisabledddlpptipempty ddlpptipappendsuccess function datadata statesprogresshideddlppagencijeappend izaberidrzddldelatnostidvalizaberi tip ddlppdrzaveempty ddlpptipemptyif rbpretragatipischeckedddllastmindrzaveappendid option ddlpptipappendnewif smestajindexofizaberi 1id option ddlppdestinacijaappendnewstatesprogresshide erroroptionid trueprev var smestajurl destvar agencijaid ddlppagencijevaldestddlppdestinacijapropdisabled false errorprevoz option ddlstatesappendnewddlppprevozparentchildrencustomselecttext if previndexofizaberistatesprogress searchload statesprogressshowtela yutaddlppprevozempty ddlppsmestajemptyfantastreplace andtolowercaseselecteditem thisval varstarddlppdrzaveappendnew optionoptionnameelse ddlppdestinacijaappendnew optionoptionnamevrste prevozaplaninskifunction dataelse if rbpretragadestischecked eachdatakatddlppuslugevalddlfminagencijeagencijaideachdataagen function idzimovanje iliddlstateszimovanjeoption if predestkatddllastminagencijeumecentarddlagnappendnew optionoptionname optionid1 dest destreplacesguslugeidoption ddlagnappendnew optionoptionname1 windowlocationhrefdata ddlstatesempty ddlppprevozemptyddlppsmestajempty ddlppuslugeemptyif rbpretragaagencijaischecked ddlppdestinacijaemptywindowlocationhref urloptionid else ifdestinacijatypedana noikluboptionid ddlppagencijeemptyvar uslasocijacija turistikih agencijatela1 smestajindexofizaberi 1novatrue truetravel servicesvar prevozid ddlppprevozvalagencije2servicesddlppagencijepropdisabled true ddlppprevozpropdisabledddlstatesemptyoption ddlppsmestajappendnewvar delatnostidsmestajid uslugaid uslugeidnacionalna asocijacijaputovanja letovanjeddlppdestinacijapropdisabled falseuslindexofizaberitrue elseoptionid ddlpptipappend izaberiddlpptipempty ddlpptipappend izaberiyuta garancijavar drzid ddlppdrzavevalddlppprevozparentchildrencustomselecttextddlstatesappendnew optionoptionname optionideachdatakatprevoztipkategorijaid ddllastmintipvalairddlppsmestajpropdisabled trueretrieve data statesprogresshideddlppsmestajappendnew optionoptionnamecrna goratipid selecteditemalma holidaysdestinaciju eachdatadestinacije functionuslugeid ddlppuslugevaleachdatadrzave function idturistike agencijepressfalseprednosti lanstvaizaberi tipuslugaidoptionid ddlfminagencijeappend izaberiseaoption ddlppprevozappendnewajaxoptionsponudaregionid regionidval varundefinedajaxoptions thrownerroruslreplacesg tolowercase urlddlmestoidval varoptionoptionname optionid ddlppsmestajappend izaberitesmestaj eachdatasmestajvar uslugeid eachdatadrzagenciju ddlppdestinacijaparentchildrencustomselecttext ifstatesprogress searchloaddata ddlstatesemptytraidest ddlppdestinacijaparentchildrencustomselecttext ifastraregijaid optionddllastminagencije varelsedrzid tipid tipidddlppdrzaveval varkrstarenjaoptionidddlppuslugeappend izaberidataid option ddlppuslugeappendnewdrzid tipidsenioraturistikihvar statesprogress searchloadtrue else ddlppdestinacijaappendnewif predest optionidurlendswith url urlsubstring0izaberiteprevindexofizaberi 1 prevtoptrue true elseprev vardestindexofizaberi 1 destindexofizaberiif previndexofizaberi 1optionid statesprogresshideamp service eachdatausluge functionvar drzpostati lanavio karteddlppsmestajparentchildrencustomselecttext ifddlfmindrzaveappendif predestddlppdrzaveappendnew optionoptionname optionidbtntrazipppropdisabledif previndexofizaberioptionid true trueurl agen varvar ddlagntrue ddlppuslugepropdisabled trueoption ifpanijaizaberi agenciju1 destindexofizaberioption ddlagnappendnewcrnatrue ddlppagencijepropdisabled truelanurllength 1 windowlocationhrefoptionoptionname optionid statesprogresshideidddlagnoptionoptionname optionid ddlppagencijeemptyvar kategorijaidurl prev varddlppprevozappend izaberioptionid ddlppsmestajappend izaberiddlmestoidbeograddaleka putovanjadrzid ddlppdrzaveval varddlfmindestinacijeappendvar usl ddlppuslugeparentchildrencustomselecttextifsmestaj ddlppsmestajparentchildrencustomselecttextbroj dana noiddlppdrzaveemptyfalse erroruslugeid success1 destbroj ponudadest ddlppdestinacijaparentchildrencustomselecttexttrue ddlppprevozpropdisabled truekatidddlppdrzaveval var tipidusluguueevar dest ddlppdestinacijaparentchildrencustomselecttextnoi vrsteagenciju eachdataagenupravnaizaberi destinacijuddlppagencijeappend izaberi agencijuwellness i spaddlppdestinacijaparentchildrencustomselecttext if destindexofizaberiagencijuget urlsmestajid smestajiddata statesprogresshide usrbijaprevozid smestajid smestajidddlppuslugeappendnewddlppagencijeempty ddlppdestinacijaappend izaberinoisearchloadddlagencije datadata ifddlppagencijeappendcache false typeregionid var eachdataagen functionminute putovanjaddlppdestinacijaparentchildrencustomselecttextxhr ajaxoptionsoptionoptionname optionid ddlpptipappendgeteachdatasmestaj function ideachdatadrz function idturizam daleka putovanjatipid ddlpptipval vardestindexofizaberi 1ddlppsmestajparentchildrencustomselecttext if smestajindexofizaberifunction xhr ajaxoptionsddlppdestinacijaappendnew optionoptionnameoptionid ddlppagencijeappend izaberismestajid uslugaidagen eachdataagencije functioncachedestinaciju eachdatadestinacijetourseachdataagen functionnacionalna asocijacija turistikihregionidval var mestoidmediteraneoizaberi destinaciju eachdatadest function idddlppdestinacijaappendnewurldestinacijusuccess functionddldelatnostidval var statesprogresstype geteachdatadestinacije function idprevozid smestajidturizamddlpptipvalddlppuslugepropdisabledvar smestajddllastmindrzaveappend izaberiprev ddlppprevozparentchildrencustomselecttext iftipid tipid agenidoptionid ddlppagencijeappendgoraddlppprevozval var smestajideachdatadrz functionsmestaj ddlppsmestajparentchildrencustomselecttext ifsearch ddlfirstmintipval varuslindexofizaberi 1 uslindexofizaberioptionid ddlppdestinacijaappendnew optionoptionnamevar prevozidsearchload statesprogressshowddlfmindrzave varddlfmindrzaveddlppagencijeappendnew optionoptionnamedestreplacesg tolowercasevar mestoid ddlmestoidvaleachdatadestinacije functionnigodinavar delatnostid ddldelatnostidvalddlppagencijevalvar destvar regionid regionidvaloption ddlpptipappendnew optionoptionnameservicenoviletoajax cache falseurl searchloadppddlkategorijaagencijaprevozsmestajuslugexhrzimovanje ili planinskidestidkako postati lanprevozaddlppuslugeemptyizdvajamoagencijaid ddlppagencijeval varbroj danavrstedrzid drzidddlagnemptymladost turistpress centarfibula eachdataageneachdataagenfalse type getddlppdrzaveappendnewvar selecteditem thisvaldrzavaidddlfmindestinacijekako eachdatadrz functionoelnosddlfminagencije var1 destindexofizaberi 1first minutedrzid ddlppdrzavevalprevreplacesg tolowercase urlizaberi usluguddlmestoidvalasocijacijavar tipid ddlpptipvalsmestajindexofizaberi 1 smestajindexofizaberidrzavu eachdataprevyuta yutakompanijeponuduprevddlppdrzaveempty ddlpptipempty ddlppdestinacijaappendstatesprogresshide ddlppdestinacijapropdisabled false1 uslpredest optioniddata destidizaberi smestajddlppdestinacijaemptycelarall ddlppdestinacijapropdisabled truedestindexofizaberi 1 destputovanja izdvajamoeachdataagencije functionspa turizamddlppdestinacijaappend izaberi destinacijuddlppsmestajpropdisabledenableall celarall ddlppdestinacijapropdisabledtipid ddlpptipvalsearchloadppddlkategorijaagencijaprevozsmestajuslugeprevindexofizaberi 1 previndexofizaberitolowercase url urlretrieverbpretragadestischecked ddlpptipempty ddlpptipappendddlppdestinacijaappend izaberieachdatausluge function idtravel agencyandtolowercase urlddlpptipappend izaberi tipegipatddlppdrzaveempty ddlppagencijeemptyedukativniili planinskieachdataprevif rbpretragatipischecked ddlppdestinacijaemptyddlpptipval var agencijaiddest destreplacesg tolowercaseurl usl ifurl uslsrbijeizaberi agencelarall ddlppdestinacijapropdisabledagenid agencijaidoptionid ddlppdrzaveappendnew optionoptionnameagencija srbijeastra tourssmestajreplacesg tolowercaseizaberidrzavu selecteditem successddllastmintipvalmestoid ddlmestoidval varsearchloadppddlkategorijaagencijaprevozsmestajusluge dataputovanja kontaktagencijaid prevozid prevozidlast minuteprevindexofizaberi 1ddlppagencijeappendnewizaberi prevoz ddlppprevozemptykategorijaid ddlfirstmintipval varagennamauslugeid success functionddlppdrzavepropdisabled eachdatadest functionddlppagencijeemptyoption ddlppdrzaveappendnewuslindexofizaberi 1 uslcache falseddlppsmestajparentchildrencustomselecttextrbpretragatipischecked ddlppdestinacijaempty ddlppdrzaveemptyvar agencijaidddlppagencijeappendnew optionoptionname optionidinternationalusl if urlendswithstar travelgrandvar destiddrzindexofizaberizdravstveni turizamagencijathisvalddlfminagencijeappendsmestajindexofizaberitipid agenidurl drzddlppsmestajappendpredrz optionid ddlppdrzaveappendnewoptionid ddlpptipappendturistikih agencijacenavar selecteditemvracoption if predrzddlmestoidval var delatnostidregionidval varprevozid prevozidddlpptipappend izaberiif rbpretragadestischecked ddlpptipemptykategorijaid ddlfirstmintipvalizaberite tipprednostistatesprogresshide ddlppdestinacijapropdisabledholidayesddlppdestinacijaempty ddlppdrzaveemptysuccessif rbpretragaagencijaischeckedddlppuslugeappend izaberi usluguoptionoptionname optionid elseturistspaizddlpptippropdisableddrzavaddlppuslugeparentchildrencustomselecttext if uslindexofizaberioptionid ddlppdestinacijaappendnewddlppprevozappendnew optionoptionname optionidoptionoptionname optionid ddlppagencijeappendsearchoptionid ddlppdrzaveappendregionid regionidvaldestid destidturizam dalekaeachdatadrzoption ddlppdrzaveappendnew optionoptionnameelse ifsmestajtrue ddlppsmestajpropdisabled trueddllastmindestinacijeappendurl dest varddlppuslugeparentchildrencustomselecttextoptionid ddlppdrzaveappend izaberiddlppdestinacijapropdisabled truealertfailed to retrieveddlfmindestinacije varreplace andtolowercase urlfantast touristoption eachdataprev function1 uslindexofizaberifalse typeelse ddlppdestinacijaappendnewagen eachdataagencijegrka letoponudepogledajddlpptipappendnewif mestoiddrz var destddlppprevozappendnew optionoptionnameradna1ddlppprevozappendnewendid option ddlppagencijeappendnewsearchload statesprogressshow ajax1 windowlocationhref urlsmestaj var usloption ddlstatesappendnew optionoptionnamesmestajid ddlppsmestajval varusl if1 prevurl url destajaxstatesprogressurl smestajbrojtipiduslugu ddlppprevozempty ddlppsmestajempty ddlppuslugeemptyuslugu eachdatauslugeselecteditem thisvalrbpretragaagencijaischeckedalertfailedddlpptipempty ddlppdestinacijaappend izaberinacionalnaddlppuslugepropdisabled truestatesprogresshideddlppdestinacijaappendasocijacija turistikihtrue ddlppsmestajpropdisabledddlppprevozpropdisabled true ddlppsmestajpropdisabledurllength 1turistikeyoudestindexofizaberiddllastmindestinacijemin searchtrueddlpptipappendnew optionoptionname optionidurl url prevddlppdestinacijaempty ddlppdrzaveempty ddlpptipemptyoption ddlppagencijeappendnewprev ddlppprevozparentchildrencustomselecttextyuta garancija putovanjaddlstatesempty ddlppprevozempty eachdatadestfalse error functioneachdatausluge functionizaberi uslugu enableall celarallsmestajreplacesgddllastmindestinacijeappend izaberioptionselectedtextreplacesgvar katddlfminagencijeappend izaberismestajid ddlppsmestajvalif uslindexofizaberiddlppuslugeappendnew optionoptionname optionidradna teladdlpptipempty ddlppdestinacijaappendusloptionoptionname optionid ddlppdrzaveappendddllastminagencijeappendoptionid ddlppuslugeappendregionajaxoptions thrownerror alertfailedoptionoptionname optionidget url searchloadppddlkategorijaagencijaprevozsmestajuslugestatesprogresshide error functionsmestajindexofizaberi 1 smestajprolena putovanjastatesprogressshow ajaxastra tours 021destreplacesgddlppsmestajappendnewholidaystipindexofizaberiklub seniorasmestaj smestajreplacesg tolowercaseddlfmindrzaveappend izaberiddlppagencijeempty ddlppdestinacijaappendif urlendswithyuta o namavar smestajidif delatnostidvar drzavaiduslugaid uslugeidid option ddlagnappendnewitemdestinaciju regionidvalid option ifoptionid ifddlppsmestajappend izaberioptionid ddlfminagencijeappendmegalosair travelmontesolfibula air travelddlppdestinacijaval vardestinacijeili planinski turizamvar kategorijaid ddlfirstmintipvalprevozid ddlppprevozvaldalekakatid kategorijaidddllastmindestinacije varholidayes travel servicesyuta laniceandtolowercaselanice yutaurl url uslddlfmindestinacijeappend izaberimladostdelatnostid ddldelatnostidval varurlendswith urlsmestaj varsmetajurl drz vardestinaciju eachdatadestdata regioniduslreplacesg tolowercaseagencyeachdatakat functionmestokarpatinaddlstatesempty ddlppprevozempty ddlppsmestajemptyddlppdestinacijapropdisabledprevozidid option ddlstatesappendnewizaberi smestaj andtolowercase url urloptionoptionname optionid ddlppprevozappend eachdatasmestajdrz varddlagnappendnew optionoptionnameddlppprevozappendtrue ddlppprevozpropdisabledelse ddlppdrzaveappendnewfunction data ddlstatesempty eachdatauslugeddlppdestinacijaappendnew optionoptionname optionidbtntrazipppropdisabled falseoptionid ddllastminagencijeappend izaberireplacetrue ddlppuslugepropdisabledurlsubstring0 urllength 1function xhrurllengthdest varzaddldelatnostideachdatasmestajthrownerror alertfailed1 previndexofizaberi 1smestajreplacesg tolowercase urlundefined varpredrz optionidfunction id optionddlppuslugeval var statesprogressprolenatours 021var kategorijaid ddllastmintipvaloptionid statesprogresshide errorizaberi destinaciju eachdatadestinacijefibula airprevoz eachdataprevampcelarallselecteditem success functionpogledaj ponududdlppsmestajvaleachdatadestinacijemin search var statesprogresspredrzoptionid statesprogresshide ddlppdestinacijapropdisabledsmestajindexofizaberi 1you putovanjaddlppsmestajval varizaberite drzavukatnameddlppagencijepropdisabled trueddlppuslugeappendxhr ajaxoptions thrownerrortrue ddlppagencijepropdisableddrzavu eachdatadrzdrziddrzid drzid tipidsearchloadppddlkategorijaagencijaprevozsmestajusluge data destidid option ddlppsmestajappendnewif destindexofizaberisveoptionid ddlppdrzaveappendnewtipindexofizaberi 1url searchloadppddlkategorijaagencijaprevozsmestajusluge dataoptionid ddlppprevozappend izaberigarancijaurl url agentolowercase urlkako postatiddlppagencijeempty ddlppagencijeappend1 usl uslreplacesgurl urlsubstring0 urllengthbanjskiddlppdrzaveval

Longtail Keyword Density for Yuta.rs

KeywordsOccurences
function id option75
-tolowercase url url18
success function data18
error function xhr16
function xhr ajaxoptions16
xhr ajaxoptions thrownerror16
ajaxoptions thrownerror alertfailed16
var statesprogress search-load16
alertfailed to retrieve16
type get url16
false type get16
cache false type16
ajax cache false16
statesprogressshow ajax cache16
search-load statesprogressshow ajax16
statesprogress search-load statesprogressshow16
optionoptionname optionid statesprogresshide15
ddlppdestinacijaappendnew optionoptionname optionid14
var selecteditem thisval14
retrieve data statesprogresshide14
ddlppdrzaveappendnew optionoptionname optionid13
function data ddlstatesempty11
statesprogresshide error function11
optionid statesprogresshide error11
eachdatadest function id10
eachdatakat function id9
ddlppdrzaveappend-- izaberi drzavu9
tip -- eachdatakat9
izaberi tip --9
id option ddlpptipappendnew9
option ddlpptipappendnew optionoptionname9
ddlpptipappend-- izaberi tip9
drzavu -- eachdatadrz9
-- eachdatadrz function9
eachdatadrz function id9
ddlppdestinacijaappend-- izaberi destinaciju9
optionid ddlppdrzaveappend-- izaberi9
optionoptionname optionid ddlppdrzaveappend--9
-- eachdatakat function9
izaberi destinaciju --9
destinaciju -- eachdatadest9
ddlpptipappendnew optionoptionname optionid9
-- eachdatadest function9
izaberi drzavu --9
option ddlppagencijeappendnew optionoptionname8
id option if8
ddlppagencijeappendnew optionoptionname optionid8
true true else8
ddlppagencijeappend-- izaberi agenciju8
optionoptionname optionid true8
id option ddlstatesappendnew8
izaberi agenciju --8
agenciju -- eachdataagen8
-- eachdataagen function8
ddlstatesappendnew optionoptionname optionid8
eachdataagen function id8
optionid true true8
option ddlstatesappendnew optionoptionname8
id option ddlppagencijeappendnew8
yuta garancija putovanja7
optionoptionname optionid else7
optionid else if7
urllength 1 windowlocationhref6
1 windowlocationhref url6
urlsubstring0 urllength 16
id option ddlppdestinacijaappendnew6
url urlsubstring0 urllength6
urlendswith url urlsubstring06
eachdataagencije function id6
selecteditem katid kategorijaid6
selecteditem thisval var6
if urlendswith url6
option ddlppdestinacijaappendnew optionoptionname6
ddlppsmestajappend-- izaberi smestaj5
option ddlppprevozappendnew optionoptionname5
prevoz -- eachdataprev5
smestaj -- eachdatasmestaj5
-- eachdatasmestaj function5
eachdatasmestaj function id5
else if rbpretragadestischecked5
optionid ddlppsmestajappend-- izaberi5
ddlppprevozappend-- izaberi prevoz5
izaberi prevoz --5
-- eachdataprev function5
id option ddlppprevozappendnew5
optionoptionname optionid ddlppuslugeappend--5
izaberi smestaj --5
eachdataprev function id5
optionoptionname optionid ddlpptipappend--5
ddlppdestinacijaempty ddlppdrzaveempty ddlpptipempty5
id option ddlppsmestajappendnew5
option ddlppsmestajappendnew optionoptionname5
ddlppsmestajappendnew optionoptionname optionid5
optionid ddlpptipappend-- izaberi5
ddlppuslugeappend-- izaberi uslugu5
optionid ddlppuslugeappend-- izaberi5
ddlppdestinacijapropdisabled false error5
-replace andtolowercase url5
url searchloadppddlkategorijaagencijaprevozsmestajusluge data5
option ddlppdrzaveappendnew optionoptionname5
id option ddlppdrzaveappendnew5
ddlppprevozempty ddlppsmestajempty ddlppuslugeempty5
false error function5
optionoptionname optionid ddlppsmestajappend--5
get url searchloadppddlkategorijaagencijaprevozsmestajusluge5
statesprogresshide ddlppdestinacijapropdisabled false5
eachdatausluge function id5
izaberi uslugu --5
uslugu -- eachdatausluge5
-- eachdatausluge function5
ddlppprevozappendnew optionoptionname optionid5
id option ddlppuslugeappendnew5
option ddlppuslugeappendnew optionoptionname5
ddlppuslugeappendnew optionoptionname optionid5
optionid ddlppprevozappend-- izaberi4
var regionid regionidval4
broj dana noi4
url agen var4
url url agen4
delatnostid ddldelatnostidval var4
var delatnostid ddldelatnostidval4
ddlmestoidval var delatnostid4
mestoid ddlmestoidval var4
var mestoid ddlmestoidval4
agen eachdataagencije function4
eachdatadrzave function id4
optionoptionname optionid ddlppprevozappend--4
izaberi agen eachdataagencije4
eachdatadestinacije function id4
optionid statesprogresshide ddlppdestinacijapropdisabled4
izaberi destinaciju eachdatadestinacije4
ddlagnappendnew optionoptionname optionid4
option ddlagnappendnew optionoptionname4
id option ddlagnappendnew4
asocijacija turistikih agencija4
min search -------4
destinaciju eachdatadestinacije function4
noi vrste prevoza4
ddlppagencijeempty ddlppagencijeappend-- izaberi4
ddlppuslugeval var statesprogress4
uslugaid uslugeid success4
smestajid uslugaid uslugeid4
ddlpptipval var agencijaid4
prevozid smestajid smestajid4
prevozid prevozid smestajid4
travel amp service4
optionid ddlppagencijeempty ddlppagencijeappend--4
var tipid ddlpptipval4
drzid drzid tipid4
searchloadppddlkategorijaagencijaprevozsmestajusluge data destid4
uslugeid ddlppuslugeval var4
if rbpretragatipischecked ddlppdestinacijaempty4
var uslugeid ddlppuslugeval4
ddlppsmestajval var uslugeid4
smestajid ddlppsmestajval var4
var smestajid ddlppsmestajval4
ddlppprevozval var smestajid4
tipid ddlpptipval var4
prevozid ddlppprevozval var4
var prevozid ddlppprevozval4
ddlppagencijeval var prevozid4
agencijaid ddlppagencijeval var4
uslugeid success function4
smestajid smestajid uslugaid4
rbpretragatipischecked ddlppdestinacijaempty ddlppdrzaveempty4
else ddlppdestinacijaappendnew optionoptionname4
optionoptionname optionid ddlppagencijeempty4
ddlpptipempty ddlpptipappend-- izaberi4
rbpretragadestischecked ddlpptipempty ddlpptipappend--4
if rbpretragadestischecked ddlpptipempty4
rbpretragaagencijaischecked ddlppdestinacijaempty ddlppdrzaveempty4
if rbpretragaagencijaischecked ddlppdestinacijaempty4
optionid ddlppagencijeappend-- izaberi4
optionoptionname optionid ddlppagencijeappend--4
else ddlppdrzaveappendnew optionoptionname4
true else ddlppdrzaveappendnew4
optionid ddlppdrzaveappendnew optionoptionname4
predrz optionid ddlppdrzaveappendnew4
if predrz optionid4
option if predrz4
var agencijaid ddlppagencijeval4
optionid ddlppdestinacijaappendnew optionoptionname4
ddlppagencijeempty ddlppdestinacijaappend-- izaberi4
option if predest4
if predest optionid4
true else ddlppdestinacijaappendnew4
predest optionid ddlppdestinacijaappendnew4
url url prev3
dest ddlppdestinacijaparentchildrencustom-selecttext if3
if destindexofizaberi -13
destindexofizaberi -1 destindexofizaberi3
url prev var3
-1 destindexofizaberi -13
var dest ddlppdestinacijaparentchildrencustom-selecttext3
destindexofizaberi -1 dest3
-1 dest destreplacesg3
url dest var3
var prev ddlppprevozparentchildrencustom-selecttext3
dest destreplacesg -tolowercase3
prevreplacesg -tolowercase url3
destreplacesg -tolowercase url3
prev prevreplacesg -tolowercase3
url url dest3
-1 prev prevreplacesg3
previndexofizaberi -1 prev3
ddlppdestinacijaparentchildrencustom-selecttext if destindexofizaberi3
previndexofizaberi -1 previndexofizaberi3
if previndexofizaberi -13
ddlppprevozparentchildrencustom-selecttext if previndexofizaberi3
prev ddlppprevozparentchildrencustom-selecttext if3
-1 previndexofizaberi -13
smestajindexofizaberi -1 smestaj3
prev var smestaj3
usl ddlppuslugeparentchildrencustom-selecttext if3
turistikih agencija srbije3
usl if urlendswith3
url usl if3
url url usl3
uslreplacesg -tolowercase url3
usl uslreplacesg -tolowercase3
-1 usl uslreplacesg3
uslindexofizaberi -1 usl3
-1 uslindexofizaberi -13
uslindexofizaberi -1 uslindexofizaberi3
if uslindexofizaberi -13
ddlppuslugeparentchildrencustom-selecttext if uslindexofizaberi3
var usl ddlppuslugeparentchildrencustom-selecttext3
var smestaj ddlppsmestajparentchildrencustom-selecttext3
smestaj var usl3
url smestaj var3
url url smestaj3
smestajreplacesg -tolowercase url3
smestaj smestajreplacesg -tolowercase3
-1 smestaj smestajreplacesg3
url drz var3
-1 smestajindexofizaberi -13
smestajindexofizaberi -1 smestajindexofizaberi3
if smestajindexofizaberi -13
ddlppsmestajparentchildrencustom-selecttext if smestajindexofizaberi3
smestaj ddlppsmestajparentchildrencustom-selecttext if3
drz var dest3
regionidval var mestoid3
url url drz3
tipid tipid agenid3
drzid tipid tipid3
data statesprogresshide ---------3
true ddlppuslugepropdisabled true3
ddlppsmestajpropdisabled true ddlppuslugepropdisabled3
true ddlppsmestajpropdisabled true3
ddlppprevozpropdisabled true ddlppsmestajpropdisabled3
true ddlppprevozpropdisabled true3
ddlppagencijepropdisabled true ddlppprevozpropdisabled3
true ddlppagencijepropdisabled true3
celarall ddlppdestinacijapropdisabled true3
enableall celarall ddlppdestinacijapropdisabled3
agenid agencijaid prevozid3
optionid ddlfminagencijeappend- izaberi3
agencijaid prevozid prevozid3
ddlstatesempty ddlppprevozempty ddlppsmestajempty3
data ddlstatesempty ddlppprevozempty3
ddlpptipempty ddlppdestinacijaappend-- izaberi3
ddlppdrzaveempty ddlpptipempty ddlppdestinacijaappend--3
ddlppdrzaveval var tipid3
drzid ddlppdrzaveval var3
var drzid ddlppdrzaveval3
ddlppdestinacijaempty ddlppdrzaveempty ddlppagencijeempty3
ddlppdrzaveempty ddlppagencijeempty ddlppdestinacijaappend--3
else if rbpretragaagencijaischecked3
selecteditem success function3
var kategorijaid ddlfirstmintipval3
yuta o nama3
function data if3
upravna i radna3
kako postati lan3
andtolowercase url url3
optionselectedtextreplacesg -tolowercase url3
klub seniora yuta3
last minute putovanja3
turizam daleka putovanja3
wellness i spa3
zimovanje ili planinski3
ili planinski turizam3
optionoptionname optionid if3
searchloadddlagencije data regionid3
kategorijaid ddlfirstmintipval var3
url searchloadddlagencije data3
get url searchloadddlagencije3
ddldelatnostidval var statesprogress3
holidayes travel services3
astra tours 0213
fibula air travel3
megalos travel agency3
ddlppdestinacijaval var drzid3
regionid regionidval var3
kategorijaid ddllastmintipval var3
var kategorijaid ddllastmintipval3
optionid ddllastminagencijeappend- izaberi3
nacionalna asocijacija turistikih3
optionoptionname optionid83
id option75
function id75
-tolowercase url26
url url21
function data18
success function18
ajaxoptions thrownerror16
error function16
get url16
statesprogressshow ajax16
false type16
cache false16
ajax cache16
search-load statesprogressshow16
statesprogress search-load16
var statesprogress16
function xhr16
xhr ajaxoptions16
type get16
thrownerror alertfailed16
var selecteditem15
optionid statesprogresshide15
ddlppdestinacijaappendnew optionoptionname14
retrieve data14
selecteditem thisval14
izaberi destinaciju14
izaberi drzavu14
data statesprogresshide14
ddlppdrzaveappendnew optionoptionname13
statesprogresshide error11
data ddlstatesempty11
eachdatadest function10
izaberi tip10
else if10
var ddlstates10
ddlppdestinacijaappend-- izaberi9
tip --9
eachdatadrz function9
-- eachdatadrz9
-- eachdatakat9
izaberi agenciju9
eachdatakat function9
ddlppdestinacijaempty ddlppdrzaveempty9
ddlpptipappend-- izaberi9
optionid ddlppdrzaveappend--9
destinaciju --9
-- eachdatadest9
drzavu --9
option ddlpptipappendnew9
ddlppdrzaveappend-- izaberi9
ddlpptipappendnew optionoptionname9
var destid8
var drzid8
option ddlstatesappendnew8
var agencijaid8
agenciju --8
ddlstatesappendnew optionoptionname8
eachdataagen function8
ddlppagencijeappend-- izaberi8
true else8
true true8
-- eachdataagen8
optionid true8
option ddlppagencijeappendnew8
ddlppagencijeappendnew optionoptionname8
option if8
thisval var7
optionid else7
evropski gradovi7
if rbpretragadestischecked7
garancija putovanja7
yuta garancija7
ddlppdestinacijapropdisabled false7
drzid drzid7
izaberi prevoz6
if rbpretragatipischecked6
if rbpretragaagencijaischecked6
option ddlppdestinacijaappendnew6
destid destid6
1 windowlocationhref6
optionselectedtextreplacesg -tolowercase6
katid kategorijaid6
if urlendswith6
urlendswith url6
url urlsubstring06
urlsubstring0 urllength6
var kategorijaid6
urllength 16
selecteditem katid6
windowlocationhref url6
previndexofizaberi -16
eachdataagencije function6
turistikih agencija6
destindexofizaberi -16
uslindexofizaberi -16
smestajindexofizaberi -16
izaberi smestaj5
ddlppsmestajappend-- izaberi5
- izaberite5
-replace andtolowercase5
andtolowercase url5
option ddlppprevozappendnew5
ddlppprevozappendnew optionoptionname5
ddlppdrzaveempty ddlpptipempty5
eachdataprev function5
-- eachdataprev5
prevoz --5
-- eachdatasmestaj5
optionid ddlpptipappend--5
last minute5
ddlppprevozappend-- izaberi5
optionid ddlppsmestajappend--5
smestaj --5
eachdatasmestaj function5
ddlppuslugeappendnew optionoptionname5
optionid ddlppuslugeappend--5
ddlppuslugeappend-- izaberi5
izaberi uslugu5
uslugu --5
-- eachdatausluge5
option ddlppuslugeappendnew5
statesprogresshide ddlppdestinacijapropdisabled5
ddlppprevozempty ddlppsmestajempty5
false error5
searchloadppddlkategorijaagencijaprevozsmestajusluge data5
url searchloadppddlkategorijaagencijaprevozsmestajusluge5
travel agency5
ddlppdestinacijaval var5
option ddlppdrzaveappendnew5
ddlppsmestajappendnew optionoptionname5
eachdatausluge function5
option ddlppsmestajappendnew5
ddlppsmestajempty ddlppuslugeempty5
var url4
option ddlagnappendnew4
ddllastmintipval var4
var ddlagn4
search -------4
ddlppagencijeempty ddlppagencijeappend--4
eachdatadrzave function4
min search4
tipindexofizaberi -14
agenindexofizaberi -14
broj dana4
dana noi4
noi vrste4
vrste prevoza4
var drzavaid4
drzindexofizaberi -14
url agen4
agen var4
agen eachdataagencije4
destinaciju eachdatadestinacije4
ddldelatnostidval var4
delatnostid ddldelatnostidval4
var delatnostid4
ddlmestoidval var4
eachdatadestinacije function4
izaberi agen4
asocijacija turistikih4
mestoid ddlmestoidval4
var mestoid4
ddlagnappendnew optionoptionname4
regionid regionidval4
var regionid4
var agen4
optionid ddlppprevozappend--4
pogledaj ponudu4
optionid ddlppagencijeempty4
agencijaid ddlppagencijeval4
ddlppuslugeval var4
uslugeid ddlppuslugeval4
var uslugeid4
ddlppsmestajval var4
smestajid ddlppsmestajval4
var smestajid4
ddlppprevozval var4
prevozid ddlppprevozval4
var prevozid4
ddlppagencijeval var4
ddlpptipval var4
drzid tipid4
tipid ddlpptipval4
var tipid4
putovanja kontakt4
lanice yuta4
prednosti lanstva4
amp service4
ddlpptipempty ddlpptipappend--4
travel amp4
yuta lanice4
daleka putovanja4
crna gora4
data destid4
avio karte4
optionid ddlppdestinacijaappendnew4
rbpretragadestischecked ddlpptipempty4
else ddlppdestinacijaappendnew4
else ddlppdrzaveappendnew4
optionid ddlppagencijeappend--4
rbpretragaagencijaischecked ddlppdestinacijaempty4
optionid ddlppdrzaveappendnew4
predest optionid4
if predest4
ddlppagencijeempty ddlppdestinacijaappend--4
rbpretragatipischecked ddlppdestinacijaempty4
predrz optionid4
uslugeid success4
prevozid smestajid4
prevozid prevozid4
if predrz4
smestajid uslugaid4
uslugaid uslugeid4
smestajid smestajid4
destreplacesg -tolowercase3
dest destreplacesg3
url drz3
drz var3
dest ddlppdestinacijaparentchildrencustom-selecttext3
var dest3
-1 dest3
ddlppdestinacijaparentchildrencustom-selecttext if3
if destindexofizaberi3
kako postati3
-1 destindexofizaberi3
radna tela3
seniora yuta3
var drz3
putovanja letovanje3
turizam daleka3
undefined var3
izaberite tip3
izaberite drzavu3
first minute3
grka leto3
minute putovanja3
postati lan3
agencija srbije3
putovanja izdvajamo3
dest var3
klub seniora3
edukativni centar3
press centar3
url dest3
-1 prev3
var prev3
yuta yuta3
usl ddlppuslugeparentchildrencustom-selecttext3
ddlppuslugeparentchildrencustom-selecttext if3
if uslindexofizaberi3
tela yuta3
-1 uslindexofizaberi3
-1 usl3
usl uslreplacesg3
smestaj var3
yuta o3
uslreplacesg -tolowercase3
url usl3
usl if3
o nama3
broj ponuda3
var usl3
url smestaj3
prev ddlppprevozparentchildrencustom-selecttext3
url prev3
ddlppprevozparentchildrencustom-selecttext if3
if previndexofizaberi3
-1 previndexofizaberi3
turistike agencije3
prev prevreplacesg3
prevreplacesg -tolowercase3
prev var3
var kat3
var smestaj3
smestaj ddlppsmestajparentchildrencustom-selecttext3
ddlppsmestajparentchildrencustom-selecttext if3
if smestajindexofizaberi3
-1 smestajindexofizaberi3
-1 smestaj3
smestaj smestajreplacesg3
smestajreplacesg -tolowercase3
kategorijaid ddllastmintipval3
if regionid3
ddlfmindrzave var3
true ddlppsmestajpropdisabled3
ddlppsmestajpropdisabled true3
true ddlppuslugepropdisabled3
ddlppuslugepropdisabled true3
statesprogresshide ---------3
star travel3
ddlfmindestinacije var3
true ddlppprevozpropdisabled3
you putovanja3
ddlfminagencije var3
selecteditem success3
ddlfmindrzaveappend- izaberi3
megalos travel3
grand tours3
ddlfmindestinacijeappend- izaberi3
ddlppprevozpropdisabled true3
ddlppagencijepropdisabled true3
ddlfminagencijeappend- izaberi3
tipid tipid3
izaberi dest3
ddlppdrzaveempty ddlppagencijeempty3
btntrazipppropdisabled false3
agencijaid prevozid3
agenid agencijaid3
tipid agenid3
drzid ddlppdrzaveval3
true ddlppagencijepropdisabled3
ddlppdrzaveval var3
ddlpptipempty ddlppdestinacijaappend--3
tipid selecteditem3
ddlstatesempty ddlppprevozempty3
enableall celarall3
celarall ddlppdestinacijapropdisabled3
ddlppdestinacijapropdisabled true3
optionid ddlfminagencijeappend-3
elnos tours3
regionid var3
banjski turizam3
zdravstveni turizam3
regionidval var3
planinski turizam3
ili planinski3
zimovanje ili3
spa turizam3
prolena putovanja3
ddllastminagencijeappend- izaberi3
url searchloadddlagencije3
searchloadddlagencije data3
data regionid3
data if3
if delatnostid3
optionid if3
if mestoid3
izaberite agenciju3
optionid ddllastminagencijeappend-3
air travel3
fantast tourist3
fibula air3
mediteraneo holidays3
alma holidays3
kategorijaid ddlfirstmintipval3
ddlfirstmintipval var3
tours 0213
astra tours3
travel services3
ddllastmindestinacijeappend- izaberi3
holidayes travel3
mladost turist3
montesol travel3
ddllastmindrzave var3
ddllastmindestinacije var3
ddllastminagencije var3
ddllastmindrzaveappend- izaberi3
nacionalna asocijacija3
var168
function123
optionid93
url90
optionoptionname83
izaberi81
id77
option75
travel75
if70
data50
--50
true45
false43
yuta41
036
putovanja36
statesprogresshide32
tours31
selecteditem30
-tolowercase29
destid24
drzid23
tip23
turizam22
agencijaid19
izaberite18
success18
type18
ajax18
else18
drzavu17
ajaxoptions16
pogledaj16
error16
xhr16
regionid16
ponuda16
get16
statesprogress16
alertfailed16
retrieve16
search-load16
statesprogressshow16
cache16
thrownerror16
thisval15
smestaj15
destinaciju15
agencija15
ddlppdestinacijaappendnew14
u14
agen14
srbija13
tipid13
ddlppdrzaveappendnew13
kategorijaid12
agenciju12
letovanje12
drzavaid12
mestoid12
prevoz12
delatnostid12
smestajid12
prevozid12
dest12
leto11
ddlstatesempty11
drz10
ddlppdestinacijaempty10
110
agenid10
str10
eachdatadest10
ddlstates10
ddlppdestinacijapropdisabled10
ddlppdrzaveempty9
ddlppdrzaveappend--9
ddlpptipappend--9
eachdatakat9
usl9
prev9
eachdatadrz9
ddlpptipempty9
ddlpptipappendnew9
ddlppdestinacijaappend--9
windowlocationhref9
eachdataagen8
noi8
dana8
ddlppagencijeappendnew8
enableall8
ddlppagencijeappend--8
uslugeid8
ddlstatesappendnew8
minute8
ddlppagencijeempty8
kat8
lanice8
rbpretragadestischecked7
27
broj7
optionselectedtextreplacesg7
agencije7
gradovi7
evropski7
turistikih7
na7
krstarenja7
garancija7
grka7
agency7
centar7
last7
predrz6
rbpretragatipischecked6
amp6
rbpretragaagencijaischecked6
destinacije6
sa6
eachdataagencije6
search6
holidays6
katid6
drzava6
destinacija6
urlendswith6
urlsubstring06
urllength6
destindexofizaberi6
previndexofizaberi6
smestajindexofizaberi6
uslindexofizaberi6
lanica6
predest6
uslugu6
ddlppsmestajempty5
ddlppuslugeappend--5
novi5
ddlppuslugeappendnew5
kontakt5
delatnost5
andtolowercase5
-replace5
eachdatausluge5
ddlppsmestajappendnew5
mesto5
eachdatasmestaj5
ddlppsmestajappend--5
ddlppprevozappendnew5
eachdataprev5
ddlppprevozappend--5
-5
turistike5
first5
beograd5
srbije5
turska5
region5
ddlppuslugeempty5
astra5
ddlppprevozempty5
o5
za5
ddlppdrzaveval5
ddlppdestinacijaval5
daleka5
searchloadppddlkategorijaagencijaprevozsmestajusluge5
izdvajamo4
eachdatadestinacije4
btntrazipppropdisabled4
ddlppuslugepropdisabled4
ddlagnappendnew4
---------4
min4
-------4
ddlagnempty4
ddlfirstmintipval4
klub4
eachdatadrzave4
lanstva4
ddllastmintipval4
drzindexofizaberi4
item4
ponudu4
prevoza4
vrste4
asocijacija4
cena4
trai4
nama4
agenindexofizaberi4
regija4
tela4
vesti4
tipindexofizaberi4
ponude4
hotel4
katname4
prednosti4
ddlppprevozpropdisabled4
kako4
ddldelatnostidval4
ddlmestoidval4
lan4
regionidval4
ddlppsmestajpropdisabled4
ddlagn4
ddlppagencijepropdisabled4
international4
ddlppprevozval4
ddlppsmestajval4
service4
karte4
avio4
po4
ddlppuslugeval4
ddlppagencijeval4
italija4
gora4
crna4
zimovanje4
uslugaid4
ume4
celarall4
ddlppdrzavepropdisabled4
ddlpptipval4
ili4
holidayes3
mladost3
smetaj3
iz3
planinski3
zdravstveni3
0213
tourist3
ddlppdestinacijaparentchildrencustom-selecttext3
fantast3
montesol3
uee3
destreplacesg3
radna3
ddlppprevozparentchildrencustom-selecttext3
prevreplacesg3
services3
vrac3
ddlppsmestajparentchildrencustom-selecttext3
top3
smestajreplacesg3
upravna3
ddlppuslugeparentchildrencustom-selecttext3
turist3
uslreplacesg3
nacionalna3
kompanije3
count3
karpati3
33
fibula3
air3
prolena3
elnos3
ddlfmindrzaveappend-3
fnrbdest3
grand3
edukativni3
sea3
ddlfminagencijeappend-3
ddlfmindestinacijeappend-3
seniora3
ddlfminagencije3
end3
alma3
ddlfmindestinacije3
ddlfmindrzave3
megalos3
star3
start3
sve3
you3
press3
ddllastmindrzave3
spa3
postati3
wellness3
banjski3
undefined3
ddlpptippropdisabled3
godina3
nova3
searchloadddlagencije3
panija3
ddllastmindestinacije3
ni3
egipat3
ddlmestoid3
ddldelatnostid3
ddllastminagencijeappend-3
ddllastmindestinacijeappend-3
ddllastmindrzaveappend-3
ddllastminagencije3
mediteraneo3

Who hosts Yuta.rs?

Yuta.rs Hosting Provider Information

Hosted IP Address:77.105.37.82
Hosted Hostname:yuta.rs
Service Provider:Drustvo za telekomunikacije Orion telekom doo Beograd, Gandijeva 76a
Hosted Country:SerbiaRS
Location Latitude:44
Location Longitude:21
Webserver Software:Microsoft-IIS/8.5

Is "Drustvo za telekomunikacije Orion telekom doo Beograd, Gandijeva 76a" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
%

HTTP Header Analysis for Yuta.rs

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-AspNetMvc-Version: 5.0
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Sun, 25 Oct 2020 02:54:28 GMT
Content-Length: 35199

Yuta.rs Domain Nameserver Information

HostIP AddressCountry
dns1.orion.rs 77.105.36.77
dns2.orion.rs 77.105.37.77
dns4.orion.rs 43.239.97.50
dns3.orion.rs 169.60.35.162


Need to find out who hosts Yuta.rs?


Domain Registration (WhoIs) information for Yuta.rs

 %
%This is the RNIDS Whois server.
%
% Date Format : DD.MM.YYYY
% Whois Server Version: 1.0.0
%
% Rights restricted by copyright.
% See http://www.rnids.rs/whois_en
%
%
%
% Ovo je odgovor od RNIDS Whois servera.
%
% Format datuma : DD.MM.YYYY
% Verzija Whois Servera : 1.0.0
%
% Sva prava zadržana. Za više informacija.
% pogledajte http://www.rnids.rs/whois_sr

Domain name: yuta.rs
Domain status: Active
Registration date: 24.04.2008 15:45:07
Modification date: 27.03.2020 11:10:57
Expiration date: 24.04.2021 15:45:07
Registrar: ORION TELEKOM d.o.o.

DNS: dns1.orion.rs - 77.105.36.77
DNS: dns2.orion.rs - 77.105.37.77
DNS: dns3.orion.rs - 169.60.35.162
DNS: dns4.orion.rs - 43.239.97.50


Registrant: Nacionalna asocijacija turistickih agencija "YUTA"
Address: Kondina 14, Beograd, Serbia
ID Number: 7008511
Tax ID: 101823808

Administrative contact: Nacionalna asocijacija turistickih agencija "YUTA"
Address: Kondina 14, Beograd, Serbia

Technical contact: Nacionalna asocijacija turistickih agencija "YUTA"
Address: Kondina 14, Beograd, Serbia

Websites with Similar Names

Yuta-blog.net
FXで楽々投資生活
Yuta-blog.tokyo
技術ブログ|技術メモ
Yuta-clinic.jp
ゆたクリニック − 津市修成町 耳鼻いんこう科・頭頸部外科・アレルギー科
Yuta-elementschild.com
エレメンツチャイルドについて
Yuta-eng.com
YUTA OFFICIAL BLOG - エンジニアのロードマップ◇高還元率派遣エンジニアによる自由になりたい全ての人へ!◇
Yuta-fukui.com
没有找到站点
Yuta-ikai.com
?????? – Just another WordPress site
Yuta-ka-nsya.com
???????????????? - ??????

Recently Updated Websites

Sigmaesco.com (1 second ago.)Freeonlinesizeandfit.com (2 seconds ago.)Ybvip3343.app (3 seconds ago.)Appartementsintelligents.com (4 seconds ago.)M2g.team (5 seconds ago.)Argogroup-realestate.com (5 seconds ago.)Kelebekhaber.com (6 seconds ago.)Marcelgruenauer.com (6 seconds ago.)Cincinnatihomesale.com (8 seconds ago.)Distributorplugin.com (9 seconds ago.)Boyu6.com (9 seconds ago.)Jokr-prm.com (9 seconds ago.)Litterreviverplus.com (10 seconds ago.)Patio.club (10 seconds ago.)Bajar-mp3.info (10 seconds ago.)Soulofsierra.com (10 seconds ago.)Oub492.app (11 seconds ago.)Vglgroup.com (11 seconds ago.)Havadoot.com (12 seconds ago.)Staystrange.com (12 seconds ago.)Chaloapp.com (12 seconds ago.)Webuymultifamilyhouses.com (16 seconds ago.)Scenttest.net (17 seconds ago.)Tinydocsbox.com (17 seconds ago.)Rentcarua.com (17 seconds ago.)American-pigeon-auction.com (17 seconds ago.)Tgeoanalytics.com (17 seconds ago.)Starmar.us (18 seconds ago.)Shrimalidataguide.com (21 seconds ago.)Tck.com.cn (21 seconds ago.)

Recently Searched Keywords

desain grafis bukan desain gratis (5 seconds ago.)chả mực bá kiến được làm từ những con mực tươi ngon từ vùng biển vịnh hạ long có chất lượng mực ngon nhất biển của việt nam (6 seconds ago.)业务分析知识体系指南 pdf (7 seconds ago.)june 27, 2020june 27, 2020 (7 seconds ago.)regus istanbul trump towers (8 seconds ago.)center trigger (10 seconds ago.)preparing for the future (2015) (12 seconds ago.)you like it (14 seconds ago.)toolstation bolton (15 seconds ago.)【ニッチ】ファミリーで外出するアクティブな1日は、マウンテンパー··· (16 seconds ago.)function of cell membrane in prokaryotic cell (16 seconds ago.)tableau (16 seconds ago.)ca00 error code toshiba (16 seconds ago.)ocak 11 hangi bur (16 seconds ago.)counterclass postsubtitle (16 seconds ago.)superbonus unico proprietario (18 seconds ago.)ali ekber bakır – pazar-ı aşk (19 seconds ago.)level co-op apartment (21 seconds ago.)chinese yuan colombian (22 seconds ago.)nw samm road: 90-day eastbound closure (22 seconds ago.)legal and privacy (23 seconds ago.)joseph clinic karama (23 seconds ago.)3 1 5000 (23 seconds ago.)šukání (25 seconds ago.)mustafa çelik (26 seconds ago.)labor force participation rate by year (27 seconds ago.)previa toyota 2006 (27 seconds ago.)ver más (27 seconds ago.)functional groups list (28 seconds ago.)government holidays 2020 bangladesh (28 seconds ago.)