Ив Роше - создатель Растительной Косметики, Интернет магазин косметики и парфюмерии. Натуральная косметика.

Интернет магазин косметики и парфюмерии Ив Роше. Растительная и натуральная косметика - купить по выгодным ценам с доставкой по Москве и России. Подарки к заказам, скидки и акции.


Domain summary

SafetyLow trust score
Year Founded
1999
Global Traffic Rank
104,391
Estimated Worth
$215,280
Last updated
2021-03-20
Domain label
yves-rocher
Domain extension
ru
Domain registered:
1999-04-27
Domain updated:
2021-03-20
Domain expires:
2021-04-30
Statvoo Rating
F
Estimated daily income
$299
Estimated monthly income
$9,095

Frequently Asked Questions (FAQ)

Q: When was Yves-rocher.ru registered?
A: Yves-rocher.ru was registered 23 years, 2 months, 1 day, 6 hours, 47 minutes, 53 seconds ago on Tuesday, April 27, 1999.
Q: When was the WHOIS for Yves-rocher.ru last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 1 week, 1 day, 6 hours, 47 minutes, 53 seconds ago on Saturday, March 20, 2021.
Q: What are Yves-rocher.ru's nameservers?
A: DNS for Yves-rocher.ru is provided by the following nameservers:
  • ns1.netnames.net
  • ns2.netnames.net
  • ns5.netnames.net
  • ns6.netnames.net
Q: Who is the registrar for the Yves-rocher.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Yves-rocher.ru?
A: Yves-rocher.ru ranks 104,391 globally on Alexa. Yves-rocher.ru has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Yves-rocher.ru each day?
A: Yves-rocher.ru receives approximately 24,944 visitors and 149,664 page impressions per day.
Q: What IP address does Yves-rocher.ru resolve to?
A: Yves-rocher.ru resolves to the IPv4 address 45.60.107.60.
Q: In what country are Yves-rocher.ru servers located in?
A: Yves-rocher.ru has servers located in the United States.
Q: What webserver software does Yves-rocher.ru use?
A: Yves-rocher.ru is powered by Apache webserver.
Q: Who hosts Yves-rocher.ru?
A: Yves-rocher.ru is hosted by Time Warner Cable Internet LLC in United States.
Q: How much is Yves-rocher.ru worth?
A: Yves-rocher.ru has an estimated worth of $215,280. An average daily income of approximately $299, which is roughly $9,095 per month.

Yves-rocher.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Yves-rocher.ru Free SEO Report

Website Inpage Analysis for Yves-rocher.ru

H1 Headings

0 :

H2 Headings

5 :
  1. Дарите подарки даже на расстоянии
  2. Act Beautiful
  3. НАШИ ОБЯЗАТЕЛЬСТВА
  4. МЫ ВСЕГДА С ВАМИ!
  5. Следите за нами в Инстаграм

H3 Headings

17 :
  1. Шампунь-Уход ВОССТАНОВЛЕНИЕ - Для поврежденных волос
  2. Сыворотка-Корректор для Молодости Кожи
  3. Набор «Обновление и гладкость»
  4. Трио «Против выпадения»
  5. Набор «Plein Soleil»
  6. Тональный Крем «Сияние и Защита от Негативных Факторов Окружающей Среды» 10Ч
  7. Масло для Очищения с Концентратом Ромашки БИО – Для чувствительной кожи
  8. Набор «Матовый эффект» в косметичке
  9. Дуэт «Питание» в косметичке
  10. Время преображения
  11. Каждый день мы выполняем наши обязательства - действуем ради красоты Женщин и Планеты
  12. МОЯ КАРТА ПРИВИЛЕГИЙ
  13. БУТИКИ ИВ РОШЕ
  14. SPA-САЛОНЫ ИВ РОШЕ
  15. Услуги
  16. УЗНАТЬ БОЛЬШЕ ОБ ИВ РОШЕ
  17. Нужна помощь?

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

69 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

263:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Yves-rocher.ru

undefined undefined trueif datalayer0campaignsourceidgridplppagedatadevicemobile gridplpcardsgridplppagedatadevicemobile gridplpcards productcardcommercialboxwrapperobserverpromotions whichvargridplpcardsdisplayundefined truedocumentqueryselectorallpostofficepricecomboxes editorialchanged by ajaxproductcardcommercialboxwrappersubtree falseonly screenmydivinsertadjacenthtmlbeforebegin 40 mydivinsertadjacenthtmlbeforebegininsertbuttonbannerlinksarraygridplppagedatadevicemobilecomboxesobserverobservedocumentgetelementbyidajaxwrappervisibleobserverobservedocumentgetelementbyidajaxwrapper childlisthiddenvpmcrmarroflinksvar elemandroidwebosiphoneipadipodblackberryiemobileopera miniitestnavigatoruseragent0ifnoteaddedfsizemutationobservermutationrecordselemitextcontentchildlist truenewname insertbuttonbannerarroflinks undefined1500 elem1 letinsert of specialdatalayer0campaignsourceid nltgiftsamplesetdisplay blockvar arroflinkspositionftextcolorcallback40 mydivinsertadjacenthtmlbeforebeginblockobserver new mutationobservermutationrecordsif datalayer0campaignsourceid nltvar arroflinks linkgridplpcards productcardcommercialboxwrapper kickercommercialboxeditorialeditorial commercialboxeditorialcontentnew mutationobservermutationrecords consolelogmutationrecordstrue ifindexwbdivhide 3 giftheader functiontruenotetryh3consolelogmutationrecordscommercialboxeditorialcontent h3movingextragiftheight 100display inlineblockchangedelem documentqueryselectorallpostofficepriceendif androidwebosiphoneipadipodblackberryiemobileoperakzfbgcolor factivecolorkickertitle fontsize 08remproductcardcommercialboxwrapper kickercommercialboxeditorialelem documentqueryselectorallpickpointpricekickercommercialboxeditorial commercialboxeditorialcontent commercialboxboxtitle3jfactivecolorelementundefined undefinedaddcatheadlinkcforher0321butikiiinstitutykrasotysl12true subtree false0 i elemlengthdocumentqueryselectorallspsrpriceappear only headerfunctionfontsizeelem documentqueryselectorallspsrpricedatatckreferencegrwidebannercomponentsamplesetcommercialboxeditorialcontent commercialboxboxtitlefirsth1colorarroflinks linkscreen3 giftinsertbuttonbannerlinksarray fsizeelemlengthdocumentlocationhrefindexofc40for30221childlist true subtreeundefined1 let observereach categorymedia onlyreadyletkickercommercialboxeditoriallinkfbgcolorkickercommercialboxeditorial commercialboxeditorialcontent h3kickersectionnonefontsize 08remcommercialboxeditorialcontenteachstylesgridplpcards productcardcommercialboxwrappereditorialcommercialboxwrapperinlineblockelem0parentnodeparentnodepreviouselementsiblingstylevisibilityhideelse if datalayer0campaignsourceidaddcatheadlinkcvapo0321butikiiinstitutykrasotysl1mydivinsertadjacenthtmlbeforebeginend comboxes editorialproductcardcommercialbox kickersection kickertitleelemlength i elemitextcontentelseobserver newheighthide 3comboxes editorial commercialboxeditorialcontentdatalayer0campaignsourceid vpmcrmmediagthresholdfactivecolor ftextcolorproductcardcommercialboxkickercommercialboxeditorial commercialboxeditorialcontentloadnote in eachinsertbuttonbannerarroflinks undefined undefinednamespecial notegoes as samplesetobserverobservedocumentgetelementbyidajaxwrapper childlist true21500 elem documentqueryselectorallpickpointprice1 var arroflinksinserttrue subtreenew mutationobservermutationrecordsfixscreen and maxwidthh3 fontsizeproductcardcommercialbox kickersectionlet observer newsampleset and appearmedia only screenleftfbgcolor factivecolor ftextcolorfalseminwidth 0pxheaderelem0parentnodeparentnodepreviouselementsiblingtextcontentpromotionsonly headeronly header functionmobmenuwidthdatalayer0campaignsourceid08remlet observer13maxwidthelemitextcontent 1500 elemkickersection kickertitle fontsizedocumentqueryselectorallspsrprice for var40 mydivinsertadjacenthtmlbeforebegin 1backgroundtop0pxgridplpproducts h1if documentlocationhrefindexofc40for30221cartproductcardcommercialboxwrappereditorialcommercialboxwrapperpromotions which goeselse if4appearchildlistfsize fbgcolorgridplpcards productcardcommercialboxwrapperif androidwebosiphoneipadipodblackberryiemobileopera miniitestnavigatoruseragentkickersection kickertitleimgmydivinsertadjacenthtmlbeforebegin 1kickertitle fontsizeappear onlyelemitextcontent 1500categoryif documentlocationhrefindexofc40for30221 0commercialboxeditorialimage9label3 gift promotionsnlt7undefined true ifwhich goesend comboxesspadocumentlocationhrefindexofc40for30221 0productcardcommercialboxwrappereditorialcommercialboxwrapper kickercommercialboxeditorialinsertbuttonbannerarroflinks undefinedgridplpproductsreturnproductcardcommercialboxwrappereditorialcommercialboxwrapper kickercommercialboxeditorial commercialboxeditorialcontentelem0parentnodeparentnodepreviouselementsiblingstylevisibility visiblename insertbuttonbannerarroflinksftextcolor twocolumnstwocolumnsgift promotionsinsertbuttonbannerlinksarray fsize fbgcolorusertokencart was changedcommercialboxboxtitlegridplpcards productcardcommercialboxwrappereditorialcommercialboxwrapper kickercommercialboxeditorialtypeoffalse ifundefined undefined undefinedcommercialboxeditorialcontent h3 fontsizeeditorialdocumentqueryselectorallpickpointpriceif datalayer0labeldocumentqueryselectorallpickpointprice for varname linkwhich5elemh1 divmydivinsertadjacenthtmlbeforebegin 40fsize fbgcolor factivecolorandroidwebosiphoneipadipodblackberryiemobileoperafirst loadvar i 0onlymutationobservermutationrecords consolelogmutationrecords6display nonedatalayer0labelgifttrackingminiitestnavigatoruseragentajax118subtree false ifkickertitlegridplpproducts h1 divgift promotions whichinsertbuttonbannerarroflinksactivelinkfinallangnamefactivecolor ftextcolor twocolumnskickercommercialboxeditorial commercialboxeditorialimagesubtreeminwidth1 vardocumentqueryselectorallpostofficeprice for varif the cartmedia screen10goesspecial

Longtail Keyword Density for Yves-rocher.ru

KeywordsOccurrences
var i 015
undefined undefined undefined14
0 i elemlength13
gridplpcards product-cardcommercial-boxwrappereditorial-commercial-boxwrapper kickercommercial-boxeditorial9
elemlength i elemitextcontent9
product-cardcommercial-boxwrappereditorial-commercial-boxwrapper kickercommercial-boxeditorial commercial-boxeditorialcontent8
-1 var arroflinks7
let observer new7
observer new mutationobservermutationrecords7
insertbuttonbannerarroflinks undefined undefined7
name insertbuttonbannerarroflinks undefined7
var arroflinks link7
childlist true subtree7
true subtree false7
undefined undefined true6
fsize fbgcolor factivecolor5
undefined true if5
factivecolor ftextcolor twocolumns5
fbgcolor factivecolor ftextcolor5
insert of special4
note in each4
appear only header4
sampleset and appear4
new mutationobservermutationrecords consolelogmutationrecords4
goes as sampleset4
observerobservedocumentgetelementbyidajax-wrapper childlist true4
promotions which goes4
gift promotions which4
3 gift promotions4
hide 3 gift4
elemitextcontent 1500 elem4
screen and max-width4
media only screen3
product-cardcommercial-box kickersection kickertitle3
changed by ajax3
cart was changed3
if the cart3
only header function3
comboxes editorial commercial-boxeditorialcontent3
kickercommercial-boxeditorial commercial-boxeditorialcontent h33
commercial-boxeditorialcontent h3 font-size3
kickercommercial-boxeditorial commercial-boxeditorialcontent commercial-boxbox-title3
gridplppagedata-devicemobile gridplpcards product-cardcommercial-boxwrapper3
gridplpcards product-cardcommercial-boxwrapper kickercommercial-boxeditorial3
end comboxes editorial3
subtree false if3
kickersection kickertitle font-size3
documentqueryselectorallspsr-price for var3
kickertitle font-size 08rem3
gridplpproducts h1 div3
insertbuttonbannerlinksarray fsize fbgcolor3
if androidwebosiphoneipadipodblackberryiemobileopera miniitestnavigatoruseragent3
-40 mydivinsertadjacenthtmlbeforebegin 13
mydivinsertadjacenthtmlbeforebegin -40 mydivinsertadjacenthtmlbeforebegin3
if documentlocationhrefindexofc40for3-0221 03
if datalayer0campaignsourceid nlt3
documentqueryselectorallpost-office-price for var3
else if datalayer0campaignsourceid3
documentqueryselectorallpickpoint-price for var3
1500 elem documentqueryselectorallpickpoint-price3
-1 let observer3
name link31
undefined undefined21
-1 var10
gridplpcards product-cardcommercial-boxwrappereditorial-commercial-boxwrapper9
product-cardcommercial-boxwrappereditorial-commercial-boxwrapper kickercommercial-boxeditorial9
kickercommercial-boxeditorial commercial-boxeditorialcontent9
var arroflinks7
true subtree7
elemitextcontent 15007
let observer7
observer new7
new mutationobservermutationrecords7
name insertbuttonbannerarroflinks7
insertbuttonbannerarroflinks undefined7
childlist true7
subtree false7
arroflinks link7
if datalayer0campaignsourceid6
undefined true6
comboxes editorial6
fsize fbgcolor5
true if5
-1 let5
var elem5
ftextcolor twocolumns5
mydivinsertadjacenthtmlbeforebegin -405
fbgcolor factivecolor5
factivecolor ftextcolor5
gridplppagedata-devicemobile gridplpcards5
1500 elem4
mutationobservermutationrecords consolelogmutationrecords4
only header4
if datalayer0label4
special note4
appear only4
which goes4
each category4
promotions which4
gift promotions4
3 gift4
hide 34
elem0parentnodeparentnodepreviouselementsiblingstylevisibility visible4
observerobservedocumentgetelementbyidajax-wrapper childlist4
documentlocationhrefindexofc40for3-0221 03
if documentlocationhrefindexofc40for3-02213
-40 mydivinsertadjacenthtmlbeforebegin3
mydivinsertadjacenthtmlbeforebegin 13
first load3
false if3
else if3
elem documentqueryselectorallpickpoint-price3
media screen3
elem documentqueryselectorallspsr-price3
product-cardcommercial-boxwrapper kickercommercial-boxeditorial3
display none3
height 1003
media only3
only screen3
min-width 0px3
display inline-block3
editorial commercial-boxeditorialcontent3
kickercommercial-boxeditorial commercial-boxeditorialimage3
commercial-boxeditorialcontent h33
h3 font-size3
commercial-boxeditorialcontent commercial-boxbox-title3
gridplpcards product-cardcommercial-boxwrapper3
end comboxes3
elem documentqueryselectorallpost-office-price3
product-cardcommercial-box kickersection3
kickersection kickertitle3
kickertitle font-size3
font-size 08rem3
gridplpproducts h13
h1 div3
insertbuttonbannerlinksarray fsize3
display block3
if androidwebosiphoneipadipodblackberryiemobileopera3
androidwebosiphoneipadipodblackberryiemobileopera miniitestnavigatoruseragent3
datalayer0campaignsourceid nlt3
datalayer0campaignsourceid vpmcrm3
header function3
link80
if64
var61
label40
name39
undefined38
030
121
datalayer0campaignsourceid20
true20
function19
end17
else15
let15
elem14
elemlength13
none13
gridplpcards12
kickercommercial-boxeditorial12
commercial-boxeditorialcontent12
fsize10
factivecolor10
fbgcolor10
data-tck-referencegrwidebannercomponent-10
ftextcolor10
mydivinsertadjacenthtmlbeforebegin10
block9
product-cardcommercial-boxwrappereditorial-commercial-boxwrapper9
display9
false9
elemitextcontent9
0px9
font-size9
28
new8
37
insertbuttonbannerarroflinks7
arroflinks7
47
subtree7
media7
childlist7
mutationobservermutationrecords7
observer7
only7
57
height7
max-width7
gthreshold6
callback6
visible6
j6
datalayer0label6
twocolumns6
noteadded6
giftsampleset6
screen6
category6
editorial6
which6
comboxes6
cart6
65
color5
spa-5
hidden5
typeof5
gridplppagedata-devicemobile5
75
left5
hide5
gridplpproducts5
min-width5
gift5
each4
insert4
note4
addcatheadlinkcvapo-0321butiki-i-instituty-krasotysl4
img4
consolelogmutationrecords4
observerobservedocumentgetelementbyidajax-wrapper4
usertoken4
special4
top4
return4
ready4
commercial-boxeditorialimage4
element4
84
promotions4
changed4
goes4
elem0parentnodeparentnodepreviouselementsiblingtextcontent4
sampleset4
appear4
header4
elem0parentnodeparentnodepreviouselementsiblingstylevisibility4
background4
activelink4
finallangname4
indexwb4
94
addcatheadlinkcfor-her-0321butiki-i-instituty-krasotysl3
documentlocationhrefindexofc40for3-02213
ajax3
first3
movingextragift3
load3
103
documentqueryselectorallpickpoint-price3
113
position3
123
inline-block3
styles3
h33
commercial-boxbox-title3
product-cardcommercial-boxwrapper3
fix3
product-cardcommercial-box3
kickersection3
kickertitle3
08rem3
kz3
documentqueryselectorallspsr-price3
h13
div3
133
mobmenuwidth3
try3
androidwebosiphoneipadipodblackberryiemobileopera3
miniitestnavigatoruseragent3
tracking3
-3
nlt3
vpmcrm3
documentqueryselectorallpost-office-price3
insertbuttonbannerlinksarray3

Who hosts Yves-rocher.ru?

Yves-rocher.ru Hosting Provider Information

Hosted IP Address:45.60.107.60
Hosted Hostname:45.60.107.60
Service Provider:Time Warner Cable Internet LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache

Is "Time Warner Cable Internet LLC" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
Time Warner Cable Internet LLC
0.0233%

Yves-rocher.ru Domain Nameserver Information

HostIP AddressCountry
ns1.netnames.net 156.154.130.100
ns2.netnames.net 156.154.131.100
ns5.netnames.net 156.154.130.100
ns6.netnames.net 156.154.131.100

Websites with Similar Names

Yves-aurelle.com
Domain Default page
Yves-bardiani-invest.com
YBI - Independant private equity firm
Yves-beaupain.com
Yves Beaupain | Un site utilisant WordPress
Yves-bouvier.biz
yves-bouvier.biz
Yves-bouvier.com
yves-bouvier.com
Yves-bouvier.info
yves-bouvier.info
Yves-bouvier.net
yves-bouvier.net
Yves-bouvier.org
yves-bouvier.org
Yves-camani.de
YVES CAMANI - Herren- und Damenuhren mit Finesse
Yves-cloutier.com
La Capitale - Erreur 404

Recently Updated Websites

Turkce-karakter.appspot.com (3 seconds ago.)Gamepitch.online (3 seconds ago.)Fjp.at (8 seconds ago.)Glitchesinthematrix.com (8 seconds ago.)Kbni.net.au (9 seconds ago.)Burambal.com (9 seconds ago.)Ihaveamac.github.io (12 seconds ago.)Wujunze.com (12 seconds ago.)Lhaasdav.com (13 seconds ago.)Teg.co.uk (15 seconds ago.)Interactive-radio-system.com (18 seconds ago.)Arcade.xyz (19 seconds ago.)Dys.tw (19 seconds ago.)Mikelalumiere.name (21 seconds ago.)Adores.cc (21 seconds ago.)Permatacargo.com (21 seconds ago.)Raycoder.me (22 seconds ago.)Wickedbyte.com (23 seconds ago.)Camchatbox.com (30 seconds ago.)Yachudo.com (33 seconds ago.)Tools.epieos.com (35 seconds ago.)Streamingcharts.com.au (36 seconds ago.)Duck.ac (37 seconds ago.)Beaddreams.biz (38 seconds ago.)Biodiversityofindia.org (39 seconds ago.)Qtech.pl (39 seconds ago.)Spectrumdmf.com (40 seconds ago.)Drcnarayanareddy.com (41 seconds ago.)Geowa4.software (43 seconds ago.)Perlpowertools.com (44 seconds ago.)

Recently Searched Keywords

robe grenat (1 second ago.)xcho пабло alemond - only you  (2 seconds ago.)income-driven & standard repayment plans (2 seconds ago.)dantų pastos (4 seconds ago.)icon mafia (5 seconds ago.)dropkick (5 seconds ago.)more recent stories » (6 seconds ago.)get the most out of our website (7 seconds ago.)juanita leysath (7 seconds ago.)am -6 pm (8 seconds ago.)vaistai nuo vidurių spazmų (8 seconds ago.)dream airlines (8 seconds ago.)tup phoenix artist (9 seconds ago.)findpersonfree.com (9 seconds ago.)word template settings (9 seconds ago.)acorus balance collagen beauty shots, skystis, 25 ml, 14 vnt. (10 seconds ago.)hasande ageru (10 seconds ago.)poisk po kartinke (10 seconds ago.)18. маја 2022.23. маја 2022. (10 seconds ago.)shep (11 seconds ago.)genel pc ipuçları (11 seconds ago.)50 ndirim (11 seconds ago.)cc kitchen bath cabinets countertops metairie la (11 seconds ago.)nuo gerklės skausmo (12 seconds ago.)contracts of employment (12 seconds ago.)h0216-英雄106 皮肤42 等级73 s9白银ii s10青铜iv (13 seconds ago.)fitticy (14 seconds ago.)payment schedules (14 seconds ago.)alquran yang (15 seconds ago.)ipevo (15 seconds ago.)