Zalando.de  |  Schuhe & Mode online kaufen | ZALANDO Online Shop
High trust score  | 
Schuhe und Mode von ├╝ber 1500 Top-Marken VERSANDKOSTENFREI bestellen - Riesen Auswahl an Schuhen, Mode, Taschen und Sports bei ? ZALANDO

Zalando.de Website Information

Zalando.de has a High trust score, a Statvoo Rank of B, an Alexa Rank of 3,308, a Majestic Rank of 16,007, a Domain Authority of 71% and is listed in DMOZ.

Zalando.de is hosted by Zalando SE in Germany.
Zalando.de has an IP Address of 91.240.34.9 and a hostname of 91.240.34.9.

The domain zalando.de was registered 201 decades 9 years 4 days ago by , it was last modified 5 years 1 month 4 days ago and currently is set to expire 201 decades 9 years 4 days ago.


Whois information for zalando.de

Full Whois Lookup for Zalando.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: zalando.de
Nserver: a1-138.akam.net
Nserver: a10-67.akam.net
Nserver: a12-64.akam.net
Nserver: a13-65.akam.net
Nserver: a2-66.akam.net
Nserver: a3-67.akam.net
Nserver: ns1.dns.interoute.net
Nserver: ns2.dns.interoute.net
Nserver: ns3.dns.interoute.net
Status: connect
Changed: 2014-09-17T18:30:47+02:00

[Tech-C]
Type: PERSON
Name: Robert Gentz
Organisation: Robert Gentz
Address: Tamara-Danz-Strasse 1
PostalCode: 10243
City: Berlin
CountryCode: DE
Phone: +49-30200088400
Fax: +49-3027594693
Email: Login to show email
2014-09-09T15:00:34+02:00

[Zone-C]
Type: PERSON
Name: Robert Gentz
Organisation: Robert Gentz
Address: Tamara-Danz-Strasse 1
PostalCode: 10243
City: Berlin
CountryCode: DE
Phone: +49-30200088400
Fax: +49-3027594693
Email: Login to show email
2014-09-09T15:00:34+02:00

Who hosts Zalando.de?

Zalando.de Web Server Information

Hosted IP Address:91.240.34.9
Hosted Hostname:91.240.34.9
Service Provider:Zalando SE
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for Zalando.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 23 May 2015 02:50:01 GMT
Server: Apache
Vary: X-Forwarded-Protocol,Host,Accept-Encoding
X-Flow-Id: UI4zaNbysk-5GQAAAABnXA
X-FRAME-OPTIONS: SAMEORIGIN
Expires: Sat, 23 May 2015 03:50:01 BST
Last-Modified: Sat, 23 May 2015 02:50:01 GMT
Pragma: no-cache
Cache-Control: no-cache, must-revalidate, no-store
P3P: CP="Zalando does not have a P3P policy. See https://www.zalando.co.uk/p3p-cookies/ for more info."
Content-Language: de-DE
Content-Encoding: gzip
Content-Length: 22459
Connection: close
Content-Type: text/html;charset=UTF-8


Need to find out who hosts Zalando.de?

Zalando.de Free SEO Report

Website Inpage Analysis for Zalando.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Zalando.de

0oderderffnenvaremailadressezalandomiteineduauf deinemonline shopfindestwunschzettelsommerunsereanmeldendurch denjetztparentzalcustomerlastnamedamensportsnavparent navlayer maxheightdeinemzumpasswortunitednavlayer0beinurnichtzalcustomerfirstnameherrenmarkupjeansmarkenesdrauenkingdommaxheightsoampnewiflipstickdafrherrennavlayer0 vardeinem wunschzettelwirfristzalando online shopwennlangenmodischsubnavdasnavlayerzalando appdirartikel auf deinemaufnikeausauchbei zalandobrandparent navlayerunited kingdomnavlayer0innerhtmlwerfenartikel aufbershopdienochnavlayer maxheightdurchdamenappunisexmarkupexpiresapp ffnensubnav parent navlayerimeinzalando onlineumtageauf deinem wunschzettelnorthdamen herrenfunctiondamenmarkupvonsubnav parenteinfachkontaktnachonlinetaschendichartikeldencategoryzufalseden sommerherrensportsnavunssocial

Longtail Keyword Density for Zalando.de

KeywordsOccurences
auf deinem wunschzettel3
artikel auf deinem3
zalando online shop3
parent navlayer max-height3
subnav parent navlayer3
zalando app4
bei zalando4
app ffnen3
united kingdom3
artikel auf3
deinem wunschzettel3
auf deinem3
den sommer3
online shop3
subnav parent3
durch den3
parent navlayer3
navlayer max-height3
zalando online3
damen herren3
navlayer0 var3
zalando26
wir19
die17
den14
der14
brand12
mit12
category12
du11
im11
zu11
amp9
ein8
app8
um8
auf8
fr7
auch7
eine7
navlayer06
false6
das6
uns5
sommer5
var5
dich5
oder5
es5
online5
nach4
bei4
so4
aus4
zum4
nike4
noch4
von4
shop4
durch4
wunschzettel4
dir3
jetzt3
anmelden3
social3
werfen3
findest3
function3
nur3
jeans3
tage3
dafr3
ffnen3
kontakt3
03
wenn3
zalcustomerfirstname3
zalcustomerlastname3
passwort3
e-mail-adresse3
united3
kingdom3
artikel3
deinem3
expires3
damenmarkup3
unsere3
damen3
max-height3
navlayer3
langen3
new3
herren3
modisch3
einfach3
marken3
taschen3
nicht3
parent3
navlayer0innerhtml3
damensportsnav3
iflipstick3
north3
herrenmarkup3
herrensportsnav3
ist3
drauen3
subnav3
unisexmarkup3
ber3

What are the nameservers for zalando.de?

Zalando.de Domain Nameserver Information

HostIP AddressCountry
a10-67.akam.net 96.7.50.67United States United States
a12-64.akam.net 184.26.160.64United States United States
a13-65.akam.net 2.22.230.65Spain Spain
a3-67.akam.net 96.7.49.67United States United States
ns1.dns.interoute.net 154.15.200.6Switzerland Switzerland
ns2.dns.interoute.net 154.15.247.98Switzerland Switzerland
ns3.dns.interoute.net 154.15.201.6Switzerland Switzerland

Zalando.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Zalando.de is a scam?