Zanussi.co.uk  |  Zanussi | Start
Low trust score  | 

Zanussi.co.uk Website Information

Zanussi.co.uk has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 331,184, a Majestic Rank of 841,471, a Domain Authority of 43% and is not listed in DMOZ.

Zanussi.co.uk is hosted by EVRY One Outsourcing Services Uppsala AB in Stockholm, Johanneshov, Sweden, 121 00.
Zanussi.co.uk has an IP Address of 193.44.77.215 and a hostname of 193.44.77.215.

The domain zanussi.co.uk was registered 2 decades 2 years 11 months ago by , it was last modified 3 years 11 months 3 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for zanussi.co.uk

Full Whois Lookup for Zanussi.co.uk Whois Lookup

Domain name:
zanussi.co.uk

Registrant:
AB Electrolux

Registrant type:
Non-UK Corporation

Registrant's address:
St Goransgatan
Stockholm
SE-105 45
Sweden

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
Corporation Service Company (UK) Limited [Tag = CSC-CORP-DOMAINS]
URL: http://www.cscprotectsbrands.com

Relevant dates:
Registered on: 21-Aug-1996
Expiry date: 21-Aug-2018
Last updated: 17-Aug-2017

Registration status:
Registered until expiry date.

Name servers:
a1-199.akam.net
a10-64.akam.net
a11-65.akam.net
a2-66.akam.net
a3-67.akam.net
a6-64.akam.net

WHOIS lookup made at 08:57:28 13-Sep-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Zanussi.co.uk?

Zanussi.co.uk Web Server Information

Hosted IP Address:193.44.77.215
Hosted Hostname:193.44.77.215
Service Provider:EVRY One Outsourcing Services Uppsala AB
Hosted Country:SwedenSE
Location Latitude:59.3333
Location Longitude:18.05
Webserver Software:Not Applicable

HTTP Header Analysis for Zanussi.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-FW: X3FW6
X-Powered-By: ASP.NET
X-UA-Compatible: IE=edge
ntCoent-Length: 103367
Content-Encoding: gzip
Content-Length: 24511
Vary: Accept-Encoding
Cache-Control: private, max-age=0
Expires: Sun, 30 Aug 2015 18:30:37 GMT
Date: Sun, 30 Aug 2015 18:30:37 GMT
Connection: keep-alive


Need to find out who hosts Zanussi.co.uk?

Zanussi.co.uk Free SEO Report

Website Inpage Analysis for Zanussi.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Zanussi.co.uk

cleanersvacuumfreezerslogfindwashingregister your productourfridgeproductdryersyour productpasswordlvacuum cleanersregister yourregistershowstrongyoumymoreyouraccessorieszanussiwashing machinesperfectrightmachinesvarsearcheasytips

Longtail Keyword Density for Zanussi.co.uk

KeywordsOccurences
register your product3
vacuum cleaners5
your product4
register your3
washing machines3
your13
you7
password6
zanussi6
product6
register6
vacuum5
cleaners5
easytips5
dryers4
search4
l4
washing4
find4
fridge4
var4
strong3
more3
right3
our3
perfect3
log3
machines3
accessories3
my3
show3
freezers3

What are the nameservers for zanussi.co.uk?

Zanussi.co.uk Domain Nameserver Information

HostIP AddressCountry
a10-64.akam.net 96.7.50.64United States United States
a11-65.akam.net 84.53.139.65United States United States
a3-67.akam.net 96.7.49.67United States United States

Zanussi.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Zanussi.co.uk is a scam?