Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents

Search for property with the UK's leading resource. Browse houses and flats for sale and to rent, and find estate agents in your area.


Domain summary

SafetyHigh trust score
Year Founded
2006
Global Traffic Rank
7,343
Estimated Worth
$927,360
Last updated
2022-05-18
Domain label
zoopla
Domain extension
co.uk
Domain registered:
2006-09-15
Domain updated:
2014-04-30
Domain expires:
0000-00-00
Statvoo Rating
B
Estimated daily income
$1,288
Estimated monthly income
$39,177

Frequently Asked Questions (FAQ)

Q: When was Zoopla.co.uk registered?
A: Zoopla.co.uk was registered 15 years, 9 months, 1 week, 4 days, 20 hours, 10 minutes, 26 seconds ago on Friday, September 15, 2006.
Q: When was the WHOIS for Zoopla.co.uk last updated?
A: The WHOIS entry was last updated 8 years, 1 month, 3 weeks, 5 days, 20 hours, 10 minutes, 26 seconds ago on Wednesday, April 30, 2014.
Q: What are Zoopla.co.uk's nameservers?
A: DNS for Zoopla.co.uk is provided by the following nameservers:
  • ns-1445.awsdns-52.org
  • ns-1625.awsdns-11.co.uk
  • ns-188.awsdns-23.com
  • ns-775.awsdns-32.net
Q: Who is the registrar for the Zoopla.co.uk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Zoopla.co.uk?
A: Zoopla.co.uk ranks 7,343 globally on Alexa. Zoopla.co.uk has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Zoopla.co.uk each day?
A: Zoopla.co.uk receives approximately 107,324 visitors and 643,944 page impressions per day.
Q: What IP address does Zoopla.co.uk resolve to?
A: Zoopla.co.uk resolves to the IPv4 address 54.194.89.89.
Q: In what country are Zoopla.co.uk servers located in?
A: Zoopla.co.uk has servers located in the Ireland.
Q: What webserver software does Zoopla.co.uk use?
A: Zoopla.co.uk is powered by Unknown webserver.
Q: Who hosts Zoopla.co.uk?
A: Zoopla.co.uk is hosted by Amazon.com, Inc. in Dublin City, Dublin, Ireland, D8.
Q: How much is Zoopla.co.uk worth?
A: Zoopla.co.uk has an estimated worth of $927,360. An average daily income of approximately $1,288, which is roughly $39,177 per month.

Zoopla.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Zoopla.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Zoopla.co.uk

H1 Headings

1 :
  1. Search properties for sale or to rent in the UK

H2 Headings

6 :
  1. Ready to move on?
  2. See what local agents think your home is worth
  3. Discover towns and cities
  4. Latest property news
  5. Join the millions getting more from their home
  6. Site links and resources

H3 Headings

21 :
  1. I need an agent
  2. I'm an agent
  3. In the city
  4. On the coast
  5. Rural and countryside
  6. Popular locations
  7. In the city
  8. On the coast
  9. Rural and countryside
  10. Popular locations
  11. Rents on new lets are rising across the UK but it's a highly localised picture
  12. Queen's speech: no fault evictions to be banned
  13. Lenders reluctant to pass on full interest rate rises to borrowers
  14. 10 homes for sale for £250,000
  15. How much is my home worth?
  16. Get closer to what matters
  17. Find an agent
  18. Explore Zoopla
  19. Build your business
  20. Links to Zoopla's social media accounts
  21. Legal and corporate information

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

136:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Zoopla.co.uk

ismobilemenuopenreturn apiurlcalcvarfontsizesunitlessforklarge448 calcvarfontsizesunitlessladlemediumlineartransitionallupvarfontsizesunitlessteapotsmallvarfontsizesladlesmalllineheightcalc100vw 320pxcustomattribute valuevarfontsizesunitlesskettlemedium0 0 0calcvarfontsizesunitlessforkmediumheader main320px 448 calcvarfontsizesunitlessladlemediumvarfontsizesforksmalllineheightcalc100vw 320px1remmedia only screenehq69sx0margintop0positionabsolutemediaismenuopenmaygetallheadersforeachfunction headervarlineheightsunitlessladlemedium varlineheightsunitlessladlesmallvarlineheightsunitlessladlesmalltransparentfontinheritfontweight600webkittextdecorationnonetextdecorationnoneletterspacinginheritwebkitappearancenonemozappearancenonemsappearancenoneappearancenoneminwidth140pxtextaligncenterwebkittransitionall 02s easeinoutbackgroundvarlineheightsunitlessladlelargevarlineheightswhisksmallmedia minwidthcalcvarfontsizesunitlessladlelarge varfontsizesunitlessladlemedium varfontsizesladlemediumlineheightcalc100vw05rem rgba50solid 322744borderbottom1px68 0080px 0pxopenminwidth448 calcvarfontsizesunitlessplatelargecalcvarfontsizesunitlessladlemediumvarlineheightsunitlesskettlemedium varlineheightsunitlesskettlesmall varlineheightskettlesmallmediaisloggedinvarlineheightsmugsmallmedia minwidth320px 448 varlineheightsunitlessteapotlargevarfontsizesunitlessforkmediumvarfontsizesladlemediumlineheightcalc100vw 320pxvarlineheightsunitlesskettlelarge varlineheightsunitlesskettlemedium varlineheightskettlemediummedia448 calcvarfontsizesunitlessplatemedium varfontsizesunitlessplatesmallvarfontsizeskettlesmalllineheightcalc100vw 320px 448limited448 varlineheightsunitlessplatelarge varlineheightsunitlessplatemedium05rem 1remnowrapmsflexflowcolumn nowrapflexflowcolumnpropertiesalertsvarfontsizeswhiskmediumlineheightcalc100vw 320pxvarlineheightsunitlessplatesmall varlineheightsplatesmallmediavarfontsizesunitlesswhisksmallbottomrail footer footervarlineheightsunitlessplatemedium varlineheightsunitlessplatesmallvarlineheightsplatemediummedia minwidthwrapflexflowcolumnvarfontsizesmugmediumlineheightcalc100vw 320pxrate risesvarlineheightsunitlesskettlemedium varlineheightsunitlesskettlesmall322744520pxzooplasavedexact namevarfontsizesunitlessforksmall varfontsizesforksmalllineheightcalc100vwwindowlocationpathnametype customattribute valuevarspaceviewportm100pagemargin content autovarfontsizesladlesmalllineheightcalc100vw 320px 4481px rgba50e15xmjtm5varlineheightsunitlesskettlesmall varlineheightskettlesmallmedia minwidthscreencalcvarfontsizesunitlesswhisklargergba50calcvarfontsizesunitlessforklarge varfontsizesunitlessforkmedium varfontsizesforkmediumlineheightcalc100vwestateautomsflex1calcvarfontsizesunitlessmugmedium varfontsizesunitlessmugsmall varfontsizesmugsmalllineheightcalc100vwcalcvarfontsizesunitlessplatemedium varfontsizesunitlessplatesmallh2fontsizecalc100vw 320pxdocumentbodystyleoverflowcalcvarfontsizesunitlessmugmediumfunction initvarlineheightswhiskmediummediaonly screenvarlineheightsunitlesskettlesmallvarspaceviewportm100pagemarginmedialinearcursorpointerwidthautopadding075rem0 automsflex1 0varsizesviewportmaxwidthcalcvarfontsizesunitlesswhiskmediumcalcvarfontsizesunitlesskettlemedium varfontsizesunitlesskettlesmall varfontsizeskettlesmalllineheightcalc100vw448 calcvarfontsizesunitlessmugmediummarginright varspaceviewportm100pagemarginmedia minwidthcalcvarfontsizesunitlessplatelarge varfontsizesunitlessplatemedium1remmediacalcvarfontsizesunitlessteapotlarge448 varlineheightsunitlesskettlelarge varlineheightsunitlesskettlemediumvarlineheightsteapotsmallmedia minwidth3227440a0px 0px320px 448 varlineheightsunitlessladlelargevarlineheightsunitlessknifemediumcalcvarfontsizesunitlessteapotmediumvarlineheightsunitlessplatemedium varlineheightsplatemediummedia minwidth448 varlineheightsunitlesswhisklargeyoudiv448 varlineheightsunitlessteapotlarge varlineheightsunitlessteapotmediumvarlineheightsunitlessteapotmedium varlineheightsteapotmediummedia minwidth0320px 05rem 1rem320px 448 calcvarfontsizesunitlessforkmedium68 0320px 05remvarfontsizesteapotsmalllineheightcalc100vw 320pxlistingstracked propertiesalerts10calcvarfontsizesunitlessplatemedium varfontsizesunitlessplatesmall varfontsizesplatesmalllineheightcalc100vwautogridtemplatecolumnsmarginleftukvarfontsizesunitlessladlemedium varfontsizesladlemediumlineheightcalc100vwauto rail autocalcvarfontsizesunitlessteapotlarge varfontsizesunitlessteapotmediumpreferencesmore account settingssignminwidth 768pxmediavarfontsizesunitlesskettlesmallvarfontsizesunitlesskettlemedium varfontsizeskettlemediumlineheightcalc100vw 320pxminmaxvarspaceviewportl100pagemargin auto content320px 448 varlineheightsunitlessladlemediumvarlineheightsteapotsmallmediaheader constfootermedia68 0040px 0px0px 0px3227440 0apikeyvarlineheightsunitlesskettlemedium varlineheightskettlemediummedia minwidthvarfontsizesunitlessmugmedium varfontsizesmugmediumlineheightcalc100vw 320pxoutelsevarfontsizesmugsmalllineheightcalc100vw 320pxminmaxvarspaceviewportl100pagemarginvarlineheightsplatemediummedianowrapwebkitflexflowcolumn nowrapmsflexflowcolumn nowrapflexflowcolumnknowrentvarsizesxs200varfontsizesplatemediumlineheightcalc100vw68 0080pxspeech0 3pxcalcvarfontsizesunitlessforklarge varfontsizesunitlessforkmediumvarfontsizesunitlessteapotmedium varfontsizesteapotmediumlineheightcalc100vw 320pxauto marginrightlocal448 calcvarfontsizesunitlesswhisklarge varfontsizesunitlesswhiskmediumvarlineheightsunitlessteapotlarge varlineheightsunitlessteapotmediumvarfontsizesunitlessforkmedium varfontsizesforkmediumlineheightcalc100vwvarfontsizesunitlessteapotmediumvarspaceviewports100pagemargin contentfullpricevarfontsizesteapotsmalllineheightcalc100vw 320px 4480media onlycalcvarfontsizesunitlessforkmedium varfontsizesunitlessforksmall8px 8px 8pxcalcvarfontsizesunitlessmuglarge varfontsizesunitlessmugmediumpropertiesvarlineheightsunitlessteapotlargesolidfull interest rate8px 3227440a0pxvarfontsizeswhisksmalllineheightcalc100vw 320pxviewbox0 0varfontsizesunitlessforksmall448 calcvarfontsizesunitlesswhiskmedium varfontsizesunitlesswhisksmallvarfontsizeskettlemediumlineheightcalc100vw02s easeinoutbackground 02svarlineheightsunitlesskettlelargeauto marginright varspaceviewportm100pagemarginmediaheader header main1px0px0media only screen1px 322744520pxnowrapwebkitflexflowcolumn nowrapmsflexflowcolumn320px 448 varlineheightsunitlessmuglargesaletovarspaceviewports100pagemargin content autovarlineheightsunitlessspoonmediumh2fontsizecalc100vwfree448 calcvarfontsizesunitlesskettlemedium varfontsizesunitlesskettlesmallvarlineheightskettlesmallmedia minwidthvarlineheightsunitlessmugmedium varlineheightsunitlessmugsmall varlineheightsmugsmallmediavarlineheightsladlesmallmedia minwidthconstvarlineheightsunitlesskettlemedium varlineheightskettlemediummediavarfontsizesunitlessforksmall varfontsizesforksmalllineheightcalc100vw 320pxvarlineheightsforkmediummedia minwidthsolid transparentfontinheritfontweight600webkittextdecorationnonetextdecorationnoneletterspacinginheritwebkitappearancenonemozappearancenonemsappearancenoneappearancenoneminwidth140pxtextaligncenterwebkittransitionall 02sauto railvarspaceviewports100pagemargintownsvarfontsizesplatesmalllineheightcalc100vw 320pxif ismobilevarfontsizesunitlessforkmedium varfontsizesforkmediumlineheightcalc100vw 320px1calcvarfontsizesunitlessmugmedium varfontsizesunitlessmugsmalllifocuswithin ehq69sx0margintop0positionabsolutemedia448 calcvarfontsizesunitlesskettlelargebottomrailcalcvarfontsizesunitlessteapotlarge varfontsizesunitlessteapotmedium varfontsizesteapotmediumlineheightcalc100vwvarlineheightsunitlessplatemedium448 varlineheightsunitlessteapotlargeismobilebutvarlineheightsteapotmediummedia minwidthvarlineheightsunitlesskettlelarge varlineheightsunitlesskettlemedium448 varlineheightsunitlesswhisklarge varlineheightsunitlesswhiskmediumrail auto footer0varlineheightsunitlessteapotlarge varlineheightsunitlessteapotmedium varlineheightsteapotmediummedia39 68 0080px0 05remfooter footer footermedianowrapmsflexflowcolumnvarlineheightsunitlessforkmedium varlineheightsunitlessforksmallmarginright varspaceviewportm100pagemarginmedia448 varlineheightsunitlesswhiskmedium11448 varlineheightsunitlessplatemediumtransparentfontinheritfontweight600webkittextdecorationnonetextdecorationnoneletterspacinginheritwebkitappearancenonemozappearancenonemsappearancenoneappearancenoneminwidth140pxtextaligncenterwebkittransitionallvarlineheightsladlesmallmediavarlineheightsunitlessteapotmedium varlineheightsunitlessteapotsmall075rem rgba50minwidth 1024pxmediavarfontsizesunitlessteapotmedium varfontsizesteapotmediumlineheightcalc100vw448 varlineheightsunitlessmuglarge0080px 0pxsearchesemail preferencesmore account448 varlineheightsunitlessladlemediumvarlineheightsunitlessplatelarge varlineheightsunitlessplatemedium varlineheightsplatemediummedialifocuswithin0px 075rem rgba50railneedvarfontsizesplatemediumlineheightcalc100vw 320px448 calcvarfontsizesunitlessmugmedium varfontsizesunitlessmugsmallfac8f0importantmedia322744borderbottom1px solid448 varlineheightsunitlessforkmedium varlineheightsunitlessforksmall320px 448 varlineheightsunitlessteapotmediumauto body autovarlineheightsunitlessladlemediumlinearboxshadow 02sbodyvarlineheightskettlemediummedia320px 448 calcvarfontsizesunitlessforklargeinit constvarfontsizesmugsmalllineheightcalc100vwmatch exact name448 varlineheightsunitlessplatemedium varlineheightsunitlessplatesmall3227440a0px 0px 1pxvarlineheightsunitlessmuglarge varlineheightsunitlessmugmediumd1d0cfborderradius4pxpadding1remoutlinenonecolor322744webkittransitionbordercolor 300mstransitionbordercolorvarlineheightsunitlessladlemedium varlineheightsladlemediummedia0 automsflex1screen and prefersreducedmotioncontent auto marginrightzooplasaved listingstrackednowrapflexflowcolumnsetoverflow320px 448 calcvarfontsizesunitlessplatemediuminterest rate rises1remnowrapwebkitflexflowcolumn448 calcvarfontsizesunitlessplatemediumcalcvarfontsizesunitlessplatelarge varfontsizesunitlessplatemedium varfontsizesplatemediumlineheightcalc100vw2remfooter footermediavarlineheightsunitlesswhiskmedium8448 varlineheightsunitlessteapotmediumvarfontsizesforkmediumlineheightcalc100vw 320pxvarlineheightsunitlesswhisklarge varlineheightsunitlesswhiskmedium varlineheightswhiskmediummediaapiurl320px 448 varlineheightsunitlesswhiskmediumvarlineheightsladlemediummedia minwidth448 calcvarfontsizesunitlessladlemedium varfontsizesunitlessladlesmallcommercial075rem rgba50 39namecalcvarfontsizesunitlesswhisklarge varfontsizesunitlesswhiskmedium960pxcssxtiwhsvarlineheightskettlemediummedia minwidth0px 075remburgermarginright minmaxvarspaceviewportl100pagemarginscreen and minwidthvarlineheightsplatesmallmedia minwidthmatch exactvarlineheightsunitlessforkmedium varlineheightsforkmediummedialinearboxshadowwrapwebkitflexflowrow wrapmsflexflowrow wrapflexflowrow960pxcss1od8khq3px fac8f0importantmediaminwidth 320pxcdiahiv448 calcvarfontsizesunitlessteapotmediumcalcvarfontsizesunitlesskettlemedium varfontsizesunitlesskettlesmallvarlineheightsunitlessmugmedium varlineheightsunitlessmugsmall3px fac8f0importantmedia only448 calcvarfontsizesunitlesskettlelarge varfontsizesunitlesskettlemedium1024pxcdiahivvarlineheightsunitlesswhisksmall varlineheightswhisksmallmediavarlineheightsunitlessplatelarge075rem3pxsaleukcalcvarfontsizesunitlesswhiskmedium varfontsizesunitlesswhisksmall varfontsizeswhisksmalllineheightcalc100vwvarlineheightsmugsmallmediacanautomsflex1 0 autoflex1varlineheightsunitlessplatemedium varlineheightsunitlessplatesmall varlineheightsplatesmallmediavarlineheightsunitlessplatelarge varlineheightsunitlessplatemediumvarfontsizeswhisksmalllineheightcalc100vw 320px 448varfontsizesunitlessteapotsmall varfontsizesteapotsmalllineheightcalc100vw 320px1024pxmediapreferencesmore account320px 448 varlineheightsunitlessmugmediumhidden320px 448 varlineheightsunitlessforklarge448 calcvarfontsizesunitlessforklarge varfontsizesunitlessforkmediumcalcvarfontsizesunitlesskettlelargehouse448 calcvarfontsizesunitlessplatelarge varfontsizesunitlessplatemedium45 190varfontsizesmugsmalllineheightcalc100vw 320px 448varlineheightsforkmediummediavarfontsizesunitlesswhiskmediumnull320px 448 calcvarfontsizesunitlessmuglargeeaseinoutbackground 02seaseinoutbackground 02s linearboxshadowvarlineheightsunitlessforkmedium15rem 0media onlyvarlineheightsunitlesswhisklarge0px 8px rgba50varfontsizeskettlesmalllineheightcalc100vw0 0 1pxallvarspaceviewportm100pagemarginmedia minwidthvarlineheightsunitlessforksmalle15xmjtm3varlineheightsunitlessmugmedium varlineheightsmugmediummedia minwidth15remvarlineheightsunitlesswhisksmallwe320px 448 varlineheightsunitlesswhisklargeexactpreferencesmorecalcvarfontsizesunitlessladlelargevarfontsizeskettlesmalllineheightcalc100vw 320pxvarlineheightswhiskmediummedia minwidth05rem 1rem 05remvarfontsizesunitlesskettlemedium varfontsizeskettlemediumlineheightcalc100vwwrapwebkitflexflowcolumn wrapmsflexflowcolumnvarfontsizesunitlessmugmedium0320px1px 32274401px rgba50 398px 8px rgba50varfontsizesunitlessladlemedium varfontsizesladlemediumlineheightcalc100vw 320px7448 calcvarfontsizesunitlessteapotlarge varfontsizesunitlessteapotmediumlipositionrelativemargin0padding0media02s linearboxshadow 02svarfontsizesunitlessplatesmall varfontsizesplatesmalllineheightcalc100vw 320pxvarfontsizesforksmalllineheightcalc100vw448 calcvarfontsizesunitlessladlelarge varfontsizesunitlessladlemedium8px448 calcvarfontsizesunitlesskettlemediuminitvarfontsizesplatesmalllineheightcalc100vwcalcvarfontsizesunitlessmuglargevarfontsizesunitlessladlemediumvarlineheightsunitlessforklarge0px 0px varsizesxs2000 0settingssignfooter footermedia minwidth4448 varlineheightsunitlessteapotmedium varlineheightsunitlessteapotsmallopenedtrackingvaluevarfontsizesforkmediumlineheightcalc100vw320px 448 calcvarfontsizesunitlessteapotmediumh2fontsizecalc100vw 320px 448automsflex1 002s linearboxshadowhamburgerelementdatasetkey68 0320pxonly768pxmediamaxwidthtrueeasetransition05s6type customattribute68 0040pxcalcvarfontsizesunitlesskettlelarge varfontsizesunitlesskettlemediumcalcvarfontsizesunitlessladlemedium varfontsizesunitlessladlesmall448 varlineheightsunitlesswhiskmedium varlineheightsunitlesswhisksmallmaineasesaleyourzooplavarfontsizesteapotsmalllineheightcalc100vwvarlineheightsunitlesskettlemediumbottomrail footervalue320px 448 calcvarfontsizesunitlesswhiskmediumvarlineheightsunitlessladlemedium varlineheightsladlemediummedia minwidthminwidth 1024pxcdiahivhomevarlineheightsunitlessmugsmallautoflex1if ismenuopenminwidth 768pxmedia minwidth768pxcdiahiv0 1remcalcvarfontsizesunitlessteapotmedium varfontsizesunitlessteapotsmallvarfontsizesunitlessplatesmalle15xmjtm5 divvarlineheightsunitlessladlemedium varlineheightsunitlessladlesmall varlineheightsladlesmallmedia448 varlineheightsunitlessladlelarge varlineheightsunitlessladlemedium0 0 3pxfootermedia minwidthvarlineheightswhisksmallmedia1rem 0easeinoutbackgroundcontent auto320px 448 calcvarfontsizesunitlesswhisklargemain bottomrailcalcvarfontsizesunitlesskettlelarge varfontsizesunitlesskettlemedium varfontsizeskettlemediumlineheightcalc100vwfunctiongetallheadersforeachfunction448 calcvarfontsizesunitlessforklarge0 15remcalcvarfontsizesunitlessplatelargesolid d1d0cfborderradius4pxpadding1remoutlinenonecolor322744webkittransitionbordercolor 300mstransitionbordercolorminwidth 960pxcss1od8khqinterest ratecalcvarfontsizesunitlessteapotmedium varfontsizesunitlessteapotsmall varfontsizesteapotsmalllineheightcalc100vw0320px 8px0px 1pxvarfontsizesunitlessplatesmall varfontsizesplatesmalllineheightcalc100vw0px 1px 322744520pxnextsiblingvarspaceviewportm100pagemarginaverage0 1pxvarlineheightsteapotmediummediacalcvarfontsizesunitlessforkmedium varfontsizesunitlessforksmall varfontsizesforksmalllineheightcalc100vwwrapwebkitflexflowrow wrapmsflexflowrowbuttoncssezbdl8buttonlinkbutton0320px 05rem448 calcvarfontsizesunitlessmuglarge varfontsizesunitlessmugmediumvarfontsizeskettlemediumlineheightcalc100vw 320px320px 448 calcvarfontsizesunitlessladlelargergba50 39headersolid 322744borderbottom1px solidlidataisloggedintruedisplaynonedataisloggedin0px 1px rgba50propertiesalerts and searchesemailvarfontsizesunitlesswhiskmedium varfontsizeswhiskmediumlineheightcalc100vw322744520px 8px 8pxvarfontsizesunitlessladlesmall448 varlineheightsunitlesskettlelarge448 varlineheightsunitlessforkmediumvarlineheightskettlesmallmediawrapmsflexflowcolumngetauto footervarlineheightsunitlessladlelarge varlineheightsunitlessladlemedium varlineheightsladlemediummedia8px rgba50calcvarfontsizesunitlessmuglarge varfontsizesunitlessmugmedium varfontsizesmugmediumlineheightcalc100vwvarfontsizesunitlessladlesmall varfontsizesladlesmalllineheightcalc100vwamp448 calcvarfontsizesunitlessladlelargezooplasaved listingstracked propertiesalertsvarlineheightsunitlesstoastermedium768pxmedia minwidthrail autoehq69sx0margintop0positionabsolutemedia onlyvarlineheightsunitlessladlesmall varlineheightsladlesmallmedia minwidthvarlineheightsladlemediummediavarlineheightsunitlessmugsmall varlineheightsmugsmallmedia minwidth39 68 0040pxwrapflexflowrowcalcvarfontsizesunitlesskettlemedium02s lineartransitionall 02sclosedtrackingvaluepropertyvarlineheightsunitlessladlesmall varlineheightsladlesmallmedia0 1px 3227440varfontsizesunitlessmugsmall0080px 0px 1px04backgroundcolortransparentbordercolorrgba12870241auto footer autogridtemplatecolumnsmarginleftclose1px 322744520px 8px300mstransitionbordercolorsolid transparentfontinheritfontweight600webkittextdecorationnonetextdecorationnoneletterspacinginheritwebkitappearancenonemozappearancenonemsappearancenoneappearancenoneminwidth140pxtextaligncenterwebkittransitionalldataattributevaluevarlineheightsmugmediummedia minwidthvarlineheightsunitlessteapotmedium varlineheightsteapotmediummediaminwidth 1024pxmedia minwidth322744borderbottom1pxvarlineheightsunitlesswhiskmedium varlineheightswhiskmediummedia minwidthvarfontsizesunitlessplatemediumvarlineheightsunitlesswhiskmedium varlineheightsunitlesswhisksmall0px 8px 3227440a0pxlinearboxshadow 02s lineartransitionall0320px 8px 8pxacrossbody auto railvarlineheightsunitlessforkmedium varlineheightsunitlessforksmall varlineheightsforksmallmediacss1er5vgl1px 3227440 0varlineheightsunitlessforksmall varlineheightsforksmallmedia minwidth2320px 448 varlineheightsunitlesskettlelarge1remmedia only448 varlineheightsunitlesskettlemedium varlineheightsunitlesskettlesmallvarfontsizesmugmediumlineheightcalc100vw 320px 4483227440 0 0viewbox005rem rgba50 39customattributesolid d1d0cfborderradius4pxpadding1remoutlinenonecolor322744webkittransitionbordercolor320px 448320px 448 varlineheightsunitlessplatemediumbody autotimeout0040px 0pxwrapmsflexflowrow wrapflexflowrowfunction init const0medianewvarlineheightsunitlessmuglarge448 varlineheightsunitlessmugmedium varlineheightsunitlessmugsmall1rem 05rem rgba50calcvarfontsizesunitlessladlelarge varfontsizesunitlessladlemediumvarspaceviewportm100pagemargin contentlineartransitionall 02svarlineheightsunitlessforklarge varlineheightsunitlessforkmedium varlineheightsforkmediummediaxmlnshttpwwww3org2000svgwrapwebkitflexflowcolumn0040px 0px 1pxlifocuswithin ehq69sx0margintop0positionabsolutemedia onlyvarlineheightsforksmallmedia minwidth448 calcvarfontsizesunitlessmuglargevarfontsizesunitlessmugmedium varfontsizesmugmediumlineheightcalc100vwvarlineheightsplatesmallmediafac8f0importantmedia only320px 448 calcvarfontsizesunitlesskettlelargeinterestsearchesemailvarlineheightsunitlessteapotsmall varlineheightsteapotsmallmediavarlineheightsunitlessplatesmall varlineheightsplatesmallmedia minwidthauto contentlihovervarlineheightsunitlessplatesmall448 calcvarfontsizesunitlessforkmedium varfontsizesunitlessforksmallnow39 68 0320px448 varlineheightsunitlessladlemedium varlineheightsunitlessladlesmall320px 448 varlineheightsunitlessforkmedium902s lineartransitionallvarfontsizesteapotmediumlineheightcalc100vw 320px8px 3227440a0px 0px448 calcvarfontsizesunitlesswhiskmedium448 varlineheightsunitlessladlelargevarlineheightsunitlessteapotsmall varlineheightsteapotsmallmedia minwidthvarlineheightsunitlessforkmedium varlineheightsforkmediummedia minwidthvarlineheightsunitlessplatemedium varlineheightsplatemediummediavarlineheightsunitlessmugsmall varlineheightsmugsmallmediaprefersreducedmotion1rem 05rem320px 448 calcvarfontsizesunitlesskettlemediumwrapmsflexflowrowvarfontsizesladlemediumlineheightcalc100vw 320px 4481024pxmedia minwidthfooter autogridtemplatecolumnsmarginleftsearchesemail preferencesmorereturnvarlineheightsforksmallmedia8px rgba50 390 3px fac8f0importantmediavarfontsizesunitlesswhisksmall varfontsizeswhisksmalllineheightcalc100vw68 0320px 8px320px 448 varlineheightsunitlessplatelargevarlineheightsunitlesskettlesmall varlineheightskettlesmallmedialineartransitionall 02s easeinoutbackgroundfac8f0importantmedia only screenvarfontsizeswhisksmalllineheightcalc100vw255 255varfontsizesmugmediumlineheightcalc100vw02s easeinoutbackground8px 8pxwrapwebkitflexflowcolumn wrapmsflexflowcolumn wrapflexflowcolumnehq69sx0margintop0positionabsolutemedia only screenfooter448 varlineheightsunitlessforklargeifvarfontsizesplatemediumlineheightcalc100vw 320px 448account settingssignvarfontsizesplatesmalllineheightcalc100vw 320px 4480 autoflex1 0accountvarlineheightsunitlessforksmall varlineheightsforksmallmediafull interestvarfontsizesladlesmalllineheightcalc100vwcalcvarfontsizesunitlesswhisklarge varfontsizesunitlesswhiskmedium varfontsizeswhiskmediumlineheightcalc100vwmain bottomrail footer320px 448 varlineheightsunitlesskettlemediumcalcvarfontsizesunitlessladlemedium varfontsizesunitlessladlesmall varfontsizesladlesmalllineheightcalc100vw320px 448 calcvarfontsizesunitlessplatelargevarlineheightsunitlessforklarge varlineheightsunitlessforkmediumwrapwebkitflexflowrow320pxcdiahiv322744520px 8pxvarfontsizesteapotmediumlineheightcalc100vw 320px 448varfontsizesunitlesskettlesmall varfontsizeskettlesmalllineheightcalc100vwinmyvarfontsizesforkmediumlineheightcalc100vw 320px 448minmaxvarspaceviewportl100pagemargin autolinearboxshadow 02s linearcursorpointerwidthautopadding075remvarfontsizesunitlessmugsmall varfontsizesmugsmalllineheightcalc100vw448 calcvarfontsizesunitlessteapotmedium varfontsizesunitlessteapotsmallvarfontsizesunitlessplatemedium varfontsizesplatemediumlineheightcalc100vw 320pxvarfontsizesunitlesskettlesmall varfontsizeskettlesmalllineheightcalc100vw 320pxreallyhomeslistingstracked02s linearcursorpointerwidthautopadding075remour02slipositionrelativemargin0padding0media onlyhome is really0080pxtransparentfontinheritfontweight600webkittextdecorationnonetextdecorationnoneletterspacinginheritwebkitappearancenonemozappearancenonemsappearancenoneappearancenoneminwidth140pxtextaligncenterwebkittransitionall 02svarfontsizesteapotmediumlineheightcalc100vwscreen and maxwidthvarlineheightsunitlessladlelarge varlineheightsunitlessladlemedium0px varsizesxs200lipositionrelativemargin0padding0media only screenvarlineheightsmugmediummedia3varlineheightsunitlessteapotmediumno05remvarfontsizesunitlessladlesmall varfontsizesladlesmalllineheightcalc100vw 320px448 varlineheightsunitlessmuglarge varlineheightsunitlessmugmediumautocalcvarfontsizesunitlessplatemediumratemarginright448 varlineheightsunitlessmugmedium3227440a0px448 varlineheightsunitlessforklarge varlineheightsunitlessforkmediumd1d0cfborderradius4pxpadding1remoutlinenonecolor322744webkittransitionbordercolor0px 8px448 varlineheightsunitlesskettlemediumfooter footerauto bodytoprailspan5wrapmsflexflowcolumn wrapflexflowcolumnminwidth 960pxcssxtiwhsmatchvarfontsizesunitlesswhiskmedium varfontsizeswhiskmediumlineheightcalc100vw 320pxvarlineheightsunitlesswhisksmall varlineheightswhisksmallmedia minwidthbrowser448 varlineheightsunitlessplatelargecalcvarfontsizesunitlesswhiskmedium varfontsizesunitlesswhisksmallvarfontsizesunitlesswhisksmall varfontsizeswhisksmalllineheightcalc100vw 320pxvarlineheightsunitlesswhiskmedium varlineheightswhiskmediummedia39 68varlineheightsunitlessmugmedium varlineheightsmugmediummediavarfontsizeswhiskmediumlineheightcalc100vw 320px 4481 spanrisesmarketvarlineheightsunitlessmuglarge varlineheightsunitlessmugmedium varlineheightsmugmediummedia15rem 0media0040pxvarlineheightsunitlesswhisklarge varlineheightsunitlesswhiskmediumproperties for salevarfontsizesunitlessplatemedium varfontsizesplatemediumlineheightcalc100vw0 autoflex1menuvarfontsizesunitlessteapotsmall varfontsizesteapotsmalllineheightcalc100vwvarlineheightsunitlessteapotmedium varlineheightsunitlessteapotsmall varlineheightsteapotsmallmedia448 calcvarfontsizesunitlessforkmediumissigninpagevarfontsizesladlemediumlineheightcalc100vwvarfontsizesforksmalllineheightcalc100vw 320px 448320px 448 calcvarfontsizesunitlessmugmedium320pxvarfontsizeskettlemediumlineheightcalc100vw 320px 448varlineheightsunitlessmugmedium448 calcvarfontsizesunitlesswhisklargeminwidth 768pxcdiahivvarlineheightsunitlessteapotsmall448 calcvarfontsizesunitlessteapotlargecontente15xmjtm3 buttoncssezbdl8buttonlinkbuttonautoflex1 0varfontsizesunitlessmugsmall varfontsizesmugsmalllineheightcalc100vw 320pxrgba50 39 68varfontsizeswhiskmediumlineheightcalc100vwmoreheader header320px 448 calcvarfontsizesunitlessteapotlargetypevarlineheightsunitlesswhiskmedium varlineheightsunitlesswhisksmall varlineheightswhisksmallmedia

Longtail Keyword Density for Zoopla.co.uk

KeywordsOccurences
screen and min-width148
0 0 3px44
02s linearbox-shadow 02s34
ease-in-outbackground 02s linearbox-shadow34
02s ease-in-outbackground 02s34
var--lineheightsunitless-ladlemedium var--lineheights-ladlemediummedia min-width33
var--lineheightsunitless-ladlemedium var--lineheightsunitless-ladlesmall var--lineheights-ladlesmallmedia33
320px 448 calcvar--fontsizesunitless-ladlemedium33
448 calcvar--fontsizesunitless-ladlemedium var--fontsizesunitless-ladlesmall33
var--fontsizesunitless-ladlesmall var--fontsizes-ladlesmallline-heightcalc100vw 320px33
var--fontsizes-ladlesmallline-heightcalc100vw 320px 44833
320px 448 var--lineheightsunitless-ladlemedium33
448 var--lineheightsunitless-ladlemedium var--lineheightsunitless-ladlesmall33
calcvar--fontsizesunitless-ladlemedium var--fontsizesunitless-ladlesmall var--fontsizes-ladlesmallline-heightcalc100vw33
var--lineheightsunitless-ladlesmall var--lineheights-ladlesmallmedia min-width33
rgba50 39 6833
448 calcvar--fontsizesunitless-ladlelarge var--fontsizesunitless-ladlemedium33
calcvar--fontsizesunitless-ladlelarge var--fontsizesunitless-ladlemedium var--fontsizes-ladlemediumline-heightcalc100vw33
var--fontsizesunitless-ladlemedium var--fontsizes-ladlemediumline-heightcalc100vw 320px33
var--fontsizes-ladlemediumline-heightcalc100vw 320px 44833
320px 448 calcvar--fontsizesunitless-ladlelarge33
320px 448 var--lineheightsunitless-ladlelarge33
448 var--lineheightsunitless-ladlelarge var--lineheightsunitless-ladlemedium33
var--lineheightsunitless-ladlelarge var--lineheightsunitless-ladlemedium var--lineheights-ladlemediummedia33
linearbox-shadow 02s lineartransitionall17
lineartransitionall 02s ease-in-outbackground17
02s lineartransitionall 02s17
linearbox-shadow 02s linearcursorpointerwidthautopadding075rem15
min-width 768pxmedia min-width15
448 calcvar--fontsizesunitless-whisklarge var--fontsizesunitless-whiskmedium12
var--fontsizes-whiskmediumline-heightcalc100vw 320px 44812
var--fontsizesunitless-whiskmedium var--fontsizes-whiskmediumline-heightcalc100vw 320px12
320px 448 var--lineheightsunitless-whisklarge12
448 var--lineheightsunitless-whisklarge var--lineheightsunitless-whiskmedium12
var--lineheightsunitless-whisksmall var--lineheights-whisksmallmedia min-width12
320px 448 calcvar--fontsizesunitless-whisklarge12
448 calcvar--fontsizesunitless-whiskmedium var--fontsizesunitless-whisksmall12
var--lineheightsunitless-whiskmedium var--lineheightsunitless-whisksmall var--lineheights-whisksmallmedia12
448 var--lineheightsunitless-whiskmedium var--lineheightsunitless-whisksmall12
320px 448 var--lineheightsunitless-whiskmedium12
var--fontsizes-whisksmallline-heightcalc100vw 320px 44812
var--fontsizesunitless-whisksmall var--fontsizes-whisksmallline-heightcalc100vw 320px12
calcvar--fontsizesunitless-whiskmedium var--fontsizesunitless-whisksmall var--fontsizes-whisksmallline-heightcalc100vw12
var--lineheightsunitless-whiskmedium var--lineheights-whiskmediummedia min-width12
320px 448 calcvar--fontsizesunitless-whiskmedium12
var--lineheightsunitless-whisklarge var--lineheightsunitless-whiskmedium var--lineheights-whiskmediummedia12
calcvar--fontsizesunitless-whisklarge var--fontsizesunitless-whiskmedium var--fontsizes-whiskmediumline-heightcalc100vw12
1px rgba50 3911
0px 1px rgba5011
39 68 0320px11
0px 0px var--sizes-xs20010
0 0 1px10
0 0 09
screen and prefers-reduced-motion8
320px 448 calcvar--fontsizesunitless-platemedium7
var--lineheightsunitless-platelarge var--lineheightsunitless-platemedium var--lineheights-platemediummedia7
448 calcvar--fontsizesunitless-platemedium var--fontsizesunitless-platesmall7
448 var--lineheightsunitless-platelarge var--lineheightsunitless-platemedium7
8px 8px -8px7
320px 448 var--lineheightsunitless-platelarge7
448 var--lineheightsunitless-platemedium var--lineheightsunitless-platesmall7
320px 448 var--lineheightsunitless-platemedium7
var--fontsizes-platemediumline-heightcalc100vw 320px 4487
var--lineheightsunitless-platemedium var--lineheightsunitless-platesmall var--lineheights-platesmallmedia7
var--lineheightsunitless-platesmall var--lineheights-platesmallmedia min-width7
320px 448 calcvar--fontsizesunitless-platelarge7
448 calcvar--fontsizesunitless-platelarge var--fontsizesunitless-platemedium7
calcvar--fontsizesunitless-platelarge var--fontsizesunitless-platemedium var--fontsizes-platemediumline-heightcalc100vw7
var--lineheightsunitless-platemedium var--lineheights-platemediummedia min-width7
var--fontsizesunitless-platemedium var--fontsizes-platemediumline-heightcalc100vw 320px7
content auto marginright7
68 0080px 0px7
screen and max-width7
-05rem rgba50 397
1rem -05rem rgba507
05rem 1rem -05rem7
0320px 05rem 1rem7
1remmedia only screen7
68 0320px 05rem7
0080px 0px 1px7
39 68 0080px7
075rem rgba50 397
0px 075rem rgba507
0media only screen7
calcvar--fontsizesunitless-platemedium var--fontsizesunitless-platesmall var--fontsizes-platesmallline-heightcalc100vw7
var--fontsizesunitless-platesmall var--fontsizes-platesmallline-heightcalc100vw 320px7
var--fontsizes-platesmallline-heightcalc100vw 320px 4487
320px 448 var--lineheightsunitless-mugmedium6
calcvar--fontsizesunitless-mugmedium var--fontsizesunitless-mugsmall var--fontsizes-mugsmallline-heightcalc100vw6
var--fontsizesunitless-mugsmall var--fontsizes-mugsmallline-heightcalc100vw 320px6
match exact name6
448 var--lineheightsunitless-mugmedium var--lineheightsunitless-mugsmall6
var--fontsizes-mugsmallline-heightcalc100vw 320px 4486
448 calcvar--fontsizesunitless-muglarge var--fontsizesunitless-mugmedium6
var--lineheightsunitless-mugmedium var--lineheightsunitless-mugsmall var--lineheights-mugsmallmedia6
var--lineheightsunitless-mugsmall var--lineheights-mugsmallmedia min-width6
320px 448 calcvar--fontsizesunitless-muglarge6
calcvar--fontsizesunitless-muglarge var--fontsizesunitless-mugmedium var--fontsizes-mugmediumline-heightcalc100vw6
var--fontsizesunitless-mugmedium var--fontsizes-mugmediumline-heightcalc100vw 320px6
var--fontsizes-mugmediumline-heightcalc100vw 320px 4486
320px 448 var--lineheightsunitless-muglarge6
448 var--lineheightsunitless-muglarge var--lineheightsunitless-mugmedium6
var--lineheightsunitless-muglarge var--lineheightsunitless-mugmedium var--lineheights-mugmediummedia6
var--lineheightsunitless-mugmedium var--lineheights-mugmediummedia min-width6
320px 448 calcvar--fontsizesunitless-mugmedium6
448 calcvar--fontsizesunitless-mugmedium var--fontsizesunitless-mugsmall6
type customattribute value6
solid transparentfontinheritfont-weight600-webkit-text-decorationnonetext-decorationnoneletter-spacinginherit-webkit-appearancenone-moz-appearancenone-ms-appearancenoneappearancenonemin-width140pxtext-aligncenter-webkit-transitionall 02s6
transparentfontinheritfont-weight600-webkit-text-decorationnonetext-decorationnoneletter-spacinginherit-webkit-appearancenone-moz-appearancenone-ms-appearancenoneappearancenonemin-width140pxtext-aligncenter-webkit-transitionall 02s ease-in-outbackground6
448 calcvar--fontsizesunitless-kettlelarge var--fontsizesunitless-kettlemedium5
calcvar--fontsizesunitless-kettlelarge var--fontsizesunitless-kettlemedium var--fontsizes-kettlemediumline-heightcalc100vw5
var--lineheightsunitless-kettlelarge var--lineheightsunitless-kettlemedium var--lineheights-kettlemediummedia5
448 var--lineheightsunitless-kettlelarge var--lineheightsunitless-kettlemedium5
320px 448 var--lineheightsunitless-kettlelarge5
var--fontsizes-kettlemediumline-heightcalc100vw 320px 4485
var--fontsizesunitless-kettlemedium var--fontsizes-kettlemediumline-heightcalc100vw 320px5
320px 448 calcvar--fontsizesunitless-kettlelarge5
3227440 0 05
var--lineheightsunitless-kettlesmall var--lineheights-kettlesmallmedia min-width5
var--lineheightsunitless-kettlemedium var--lineheightsunitless-kettlesmall var--lineheights-kettlesmallmedia5
448 var--lineheightsunitless-kettlemedium var--lineheightsunitless-kettlesmall5
320px 448 var--lineheightsunitless-kettlemedium5
var--fontsizes-kettlesmallline-heightcalc100vw 320px 4485
var--fontsizesunitless-kettlesmall var--fontsizes-kettlesmallline-heightcalc100vw 320px5
calcvar--fontsizesunitless-kettlemedium var--fontsizesunitless-kettlesmall var--fontsizes-kettlesmallline-heightcalc100vw5
448 calcvar--fontsizesunitless-kettlemedium var--fontsizesunitless-kettlesmall5
var--lineheightsunitless-kettlemedium var--lineheights-kettlemediummedia min-width5
1px 3227440 05
320px 448 calcvar--fontsizesunitless-kettlemedium5
0 1px 32274405
0px 1px 322744520px5
1px 322744520px 8px5
0040px 0px 1px4
h2font-sizecalc100vw 320px 4484
0px 8px rgba504
8px rgba50 394
39 68 0040px4
68 0040px 0px4
bottomrail footer footer4
auto body auto4
var--lineheightsunitless-forksmall var--lineheights-forksmallmedia min-width4
0320px 8px 8px4
8px -8px rgba504
-8px rgba50 394
0 3px fac8f0importantmedia4
3px fac8f0importantmedia only4
fac8f0importantmedia only screen4
68 0320px 8px4
var--lineheightsunitless-forkmedium var--lineheightsunitless-forksmall var--lineheights-forksmallmedia4
footer footer footermedia4
var--fontsizes-forksmallline-heightcalc100vw 320px 4484
320px 448 calcvar--fontsizesunitless-forklarge4
448 calcvar--fontsizesunitless-forklarge var--fontsizesunitless-forkmedium4
var--fontsizesunitless-forkmedium var--fontsizes-forkmediumline-heightcalc100vw 320px4
var--fontsizes-forkmediumline-heightcalc100vw 320px 4484
320px 448 var--lineheightsunitless-forklarge4
448 var--lineheightsunitless-forklarge var--lineheightsunitless-forkmedium4
var--lineheightsunitless-forklarge var--lineheightsunitless-forkmedium var--lineheights-forkmediummedia4
var--lineheightsunitless-forkmedium var--lineheights-forkmediummedia min-width4
footer footermedia min-width4
448 var--lineheightsunitless-forkmedium var--lineheightsunitless-forksmall4
320px 448 var--lineheightsunitless-forkmedium4
calcvar--fontsizesunitless-forklarge var--fontsizesunitless-forkmedium var--fontsizes-forkmediumline-heightcalc100vw4
var--fontsizesunitless-forksmall var--fontsizes-forksmallline-heightcalc100vw 320px4
320px 448 calcvar--fontsizesunitless-forkmedium4
calcvar--fontsizesunitless-forkmedium var--fontsizesunitless-forksmall var--fontsizes-forksmallline-heightcalc100vw4
448 calcvar--fontsizesunitless-forkmedium var--fontsizesunitless-forksmall4
8px 3227440a0px 0px3
0px 8px 3227440a0px3
448 calcvar--fontsizesunitless-teapotmedium var--fontsizesunitless-teapotsmall3
320px 448 calcvar--fontsizesunitless-teapotmedium3
minmaxvar--space-viewportl100pagemargin auto content3
marginright var--space-viewportm100pagemarginmedia min-width3
auto marginright var--space-viewportm100pagemarginmedia3
var--space-viewportm100pagemargin content auto3
var--space-viewports100pagemargin content auto3
auto footer autogrid-template-columnsmarginleft3
nowrap-webkit-flex-flowcolumn nowrap-ms-flex-flowcolumn nowrapflex-flowcolumn3
322744520px 8px 8px3
header header main3
interest rate rises3
calcvar--fontsizesunitless-teapotmedium var--fontsizesunitless-teapotsmall var--fontsizes-teapotsmallline-heightcalc100vw3
min-width 1024pxmedia min-width3
3227440a0px 0px 1px3
zooplasaved listingstracked propertiesalerts3
propertiesalerts and searchesemail3
searchesemail preferencesmore account3
preferencesmore account settingssign3
function init const3
home is really3
properties for sale3
full interest rate3
main bottomrail footer3
var--fontsizes-teapotsmallline-heightcalc100vw 320px 4483
wrap-webkit-flex-flowrow wrap-ms-flex-flowrow wrapflex-flowrow3
solid 322744border-bottom1px solid3
var--lineheightsunitless-teapotmedium var--lineheights-teapotmediummedia min-width3
var--lineheightsunitless-teapotlarge var--lineheightsunitless-teapotmedium var--lineheights-teapotmediummedia3
448 var--lineheightsunitless-teapotlarge var--lineheightsunitless-teapotmedium3
320px 448 var--lineheightsunitless-teapotlarge3
var--fontsizes-teapotmediumline-heightcalc100vw 320px 4483
var--fontsizesunitless-teapotmedium var--fontsizes-teapotmediumline-heightcalc100vw 320px3
rail auto footer3
auto rail auto3
body auto rail3
calcvar--fontsizesunitless-teapotlarge var--fontsizesunitless-teapotmedium var--fontsizes-teapotmediumline-heightcalc100vw3
15rem 0media only3
448 calcvar--fontsizesunitless-teapotlarge var--fontsizesunitless-teapotmedium3
var--fontsizesunitless-teapotsmall var--fontsizes-teapotsmallline-heightcalc100vw 320px3
320px 448 calcvar--fontsizesunitless-teapotlarge3
var--lineheightsunitless-teapotsmall var--lineheights-teapotsmallmedia min-width3
solid d1d0cfborder-radius4pxpadding1remoutlinenonecolor322744-webkit-transitionborder-color 300mstransitionborder-color3
0 autoflex1 03
auto-ms-flex1 0 autoflex13
0 auto-ms-flex1 03
448 var--lineheightsunitless-teapotmedium var--lineheightsunitless-teapotsmall3
320px 448 var--lineheightsunitless-teapotmedium3
ehq69sx0margin-top0positionabsolutemedia only screen3
lifocus-within ehq69sx0margin-top0positionabsolutemedia only3
lipositionrelativemargin0padding0media only screen3
wrap-webkit-flex-flowcolumn wrap-ms-flex-flowcolumn wrapflex-flowcolumn3
var--lineheightsunitless-teapotmedium var--lineheightsunitless-teapotsmall var--lineheights-teapotsmallmedia3
320px 448308
only screen155
0 079
0 3px44
02s ease-in-outbackground34
ease-in-outbackground 02s34
02s linearbox-shadow34
linearbox-shadow 02s34
448 var--lineheightsunitless-ladlemedium33
var--lineheightsunitless-ladlelarge var--lineheightsunitless-ladlemedium33
var--lineheights-ladlesmallmedia min-width33
var--lineheights-ladlemediummedia min-width33
var--lineheightsunitless-ladlemedium var--lineheights-ladlemediummedia33
448 var--lineheightsunitless-ladlelarge33
var--fontsizes-ladlesmallline-heightcalc100vw 320px33
var--fontsizes-ladlemediumline-heightcalc100vw 320px33
calcvar--fontsizesunitless-ladlelarge var--fontsizesunitless-ladlemedium33
448 calcvar--fontsizesunitless-ladlelarge33
var--lineheightsunitless-ladlemedium var--lineheightsunitless-ladlesmall33
448 calcvar--fontsizesunitless-ladlemedium33
calcvar--fontsizesunitless-ladlemedium var--fontsizesunitless-ladlesmall33
var--fontsizesunitless-ladlesmall var--fontsizes-ladlesmallline-heightcalc100vw33
var--fontsizesunitless-ladlemedium var--fontsizes-ladlemediumline-heightcalc100vw33
var--lineheightsunitless-ladlesmall var--lineheights-ladlesmallmedia33
rgba50 3933
39 6833
02s lineartransitionall17
lineartransitionall 02s17
0px 1px16
768pxmedia min-width15
min-width 768pxmedia15
02s linearcursorpointerwidthautopadding075rem15
0px 0px13
var--fontsizesunitless-whiskmedium var--fontsizes-whiskmediumline-heightcalc100vw12
var--lineheights-whisksmallmedia min-width12
448 var--lineheightsunitless-whisklarge12
var--fontsizes-whiskmediumline-heightcalc100vw 320px12
calcvar--fontsizesunitless-whisklarge var--fontsizesunitless-whiskmedium12
448 calcvar--fontsizesunitless-whisklarge12
calcvar--fontsizesunitless-whiskmedium var--fontsizesunitless-whisksmall12
var--lineheightsunitless-whisksmall var--lineheights-whisksmallmedia12
var--lineheightsunitless-whiskmedium var--lineheightsunitless-whisksmall12
448 var--lineheightsunitless-whiskmedium12
var--fontsizes-whisksmallline-heightcalc100vw 320px12
var--fontsizesunitless-whisksmall var--fontsizes-whisksmallline-heightcalc100vw12
var--lineheightsunitless-whiskmedium var--lineheights-whiskmediummedia12
var--lineheightsunitless-whisklarge var--lineheightsunitless-whiskmedium12
448 calcvar--fontsizesunitless-whiskmedium12
var--lineheights-whiskmediummedia min-width12
68 0320px11
1px rgba5011
0px var--sizes-xs20010
0 1px10
var--lineheightsunitless-platelarge var--lineheightsunitless-platemedium7
content auto7
auto marginright7
header header7
footer footer7
0px 8px7
448 var--lineheightsunitless-platelarge7
var--fontsizes-platemediumline-heightcalc100vw 320px7
0px 075rem7
075rem rgba507
var--lineheightsunitless-platemedium var--lineheights-platemediummedia7
var--lineheights-platemediummedia min-width7
var--fontsizesunitless-platemedium var--fontsizes-platemediumline-heightcalc100vw7
8px -8px7
8px 8px7
calcvar--fontsizesunitless-platelarge var--fontsizesunitless-platemedium7
448 calcvar--fontsizesunitless-platelarge7
448 calcvar--fontsizesunitless-platemedium7
var--lineheights-platesmallmedia min-width7
var--lineheightsunitless-platesmall var--lineheights-platesmallmedia7
448 var--lineheightsunitless-platemedium7
0320px 05rem7
1remmedia only7
05rem 1rem7
1rem -05rem7
-05rem rgba507
var--lineheightsunitless-platemedium var--lineheightsunitless-platesmall7
var--fontsizes-platesmallline-heightcalc100vw 320px7
68 0080px7
var--fontsizesunitless-platesmall var--fontsizes-platesmallline-heightcalc100vw7
calcvar--fontsizesunitless-platemedium var--fontsizesunitless-platesmall7
0media only7
0080px 0px7
match exact6
exact name6
type customattribute6
calcvar--fontsizesunitless-muglarge var--fontsizesunitless-mugmedium6
var--fontsizesunitless-mugmedium var--fontsizes-mugmediumline-heightcalc100vw6
var--lineheights-mugmediummedia min-width6
var--lineheightsunitless-mugmedium var--lineheights-mugmediummedia6
448 calcvar--fontsizesunitless-mugmedium6
calcvar--fontsizesunitless-mugmedium var--fontsizesunitless-mugsmall6
var--fontsizesunitless-mugsmall var--fontsizes-mugsmallline-heightcalc100vw6
var--lineheightsunitless-muglarge var--lineheightsunitless-mugmedium6
448 var--lineheightsunitless-muglarge6
var--fontsizes-mugmediumline-heightcalc100vw 320px6
var--fontsizes-mugsmallline-heightcalc100vw 320px6
448 var--lineheightsunitless-mugmedium6
var--lineheightsunitless-mugmedium var--lineheightsunitless-mugsmall6
var--lineheights-mugsmallmedia min-width6
448 calcvar--fontsizesunitless-muglarge6
var--lineheightsunitless-mugsmall var--lineheights-mugsmallmedia6
customattribute value6
solid transparentfontinheritfont-weight600-webkit-text-decorationnonetext-decorationnoneletter-spacinginherit-webkit-appearancenone-moz-appearancenone-ms-appearancenoneappearancenonemin-width140pxtext-aligncenter-webkit-transitionall6
transparentfontinheritfont-weight600-webkit-text-decorationnonetext-decorationnoneletter-spacinginherit-webkit-appearancenone-moz-appearancenone-ms-appearancenoneappearancenonemin-width140pxtext-aligncenter-webkit-transitionall 02s6
var--fontsizesunitless-kettlemedium var--fontsizes-kettlemediumline-heightcalc100vw5
448 calcvar--fontsizesunitless-kettlelarge5
var--lineheightsunitless-kettlemedium var--lineheights-kettlemediummedia5
var--lineheightsunitless-kettlelarge var--lineheightsunitless-kettlemedium5
448 var--lineheightsunitless-kettlelarge5
var--fontsizes-kettlemediumline-heightcalc100vw 320px5
calcvar--fontsizesunitless-kettlelarge var--fontsizesunitless-kettlemedium5
var--lineheights-kettlesmallmedia min-width5
3227440 05
var--lineheightsunitless-kettlesmall var--lineheights-kettlesmallmedia5
var--lineheightsunitless-kettlemedium var--lineheightsunitless-kettlesmall5
448 var--lineheightsunitless-kettlemedium5
var--fontsizes-kettlesmallline-heightcalc100vw 320px5
var--fontsizesunitless-kettlesmall var--fontsizes-kettlesmallline-heightcalc100vw5
calcvar--fontsizesunitless-kettlemedium var--fontsizesunitless-kettlesmall5
448 calcvar--fontsizesunitless-kettlemedium5
0 15rem5
var--lineheights-kettlemediummedia min-width5
1px 32274405
322744520px 8px5
1px 322744520px5
body auto4
1 span4
1rem 04
return apiurl4
getallheadersforeachfunction header4
min-width 1024pxc-diahiv4
h2font-sizecalc100vw 320px4
8px rgba504
min-width 960pxcss-1od8khq4
68 0040px4
0040px 0px4
0320px 8px4
-8px rgba504
3px fac8f0importantmedia4
fac8f0importantmedia only4
e15xmjtm5 div4
auto body4
var--lineheightsunitless-forkmedium var--lineheightsunitless-forksmall4
footermedia min-width4
448 var--lineheightsunitless-forkmedium4
var--lineheights-forkmediummedia min-width4
var--lineheightsunitless-forkmedium var--lineheights-forkmediummedia4
var--lineheightsunitless-forklarge var--lineheightsunitless-forkmedium4
448 var--lineheightsunitless-forklarge4
448 calcvar--fontsizesunitless-forkmedium4
var--fontsizes-forkmediumline-heightcalc100vw 320px4
calcvar--fontsizesunitless-forkmedium var--fontsizesunitless-forksmall4
var--fontsizesunitless-forksmall var--fontsizes-forksmallline-heightcalc100vw4
var--fontsizes-forksmallline-heightcalc100vw 320px4
footer footermedia4
var--fontsizesunitless-forkmedium var--fontsizes-forkmediumline-heightcalc100vw4
calcvar--fontsizesunitless-forklarge var--fontsizesunitless-forkmedium4
bottomrail footer4
448 calcvar--fontsizesunitless-forklarge4
var--lineheightsunitless-forksmall var--lineheights-forksmallmedia4
var--lineheights-forksmallmedia min-width4
min-width 768pxc-diahiv3
wrap-webkit-flex-flowrow wrap-ms-flex-flowrow3
nowrap-ms-flex-flowcolumn nowrapflex-flowcolumn3
wrap-ms-flex-flowrow wrapflex-flowrow3
min-width 320pxc-diahiv3
main bottomrail3
min-width 1024pxmedia3
var--space-viewports100pagemargin content3
if ismenuopen3
8px 3227440a0px3
3227440a0px 0px3
minmaxvar--space-viewportl100pagemargin auto3
rate rises3
interest rate3
full interest3
var--space-viewportm100pagemarginmedia min-width3
init const3
function init3
header const3
e15xmjtm3 buttoncss-ezbdl8-buttonlink-button3
marginright var--space-viewportm100pagemarginmedia3
if ismobile3
account settingssign3
preferencesmore account3
searchesemail preferencesmore3
listingstracked propertiesalerts3
zooplasaved listingstracked3
var--space-viewportm100pagemargin content3
nowrap-webkit-flex-flowcolumn nowrap-ms-flex-flowcolumn3
1024pxmedia min-width3
45 1903
ehq69sx0margin-top0positionabsolutemedia only3
wrap-webkit-flex-flowcolumn wrap-ms-flex-flowcolumn3
322744border-bottom1px solid3
448 calcvar--fontsizesunitless-teapotlarge3
calcvar--fontsizesunitless-teapotlarge var--fontsizesunitless-teapotmedium3
var--fontsizesunitless-teapotmedium var--fontsizes-teapotmediumline-heightcalc100vw3
var--fontsizes-teapotmediumline-heightcalc100vw 320px3
448 var--lineheightsunitless-teapotlarge3
0 1rem3
solid 322744border-bottom1px3
var--lineheightsunitless-teapotlarge var--lineheightsunitless-teapotmedium3
var--lineheightsunitless-teapotsmall var--lineheights-teapotsmallmedia3
15rem 0media3
var--lineheightsunitless-teapotmedium var--lineheights-teapotmediummedia3
255 2553
var--lineheights-teapotmediummedia min-width3
auto rail3
rail auto3
auto footer3
footer autogrid-template-columnsmarginleft3
var--lineheights-teapotsmallmedia min-width3
var--lineheightsunitless-teapotmedium var--lineheightsunitless-teapotsmall3
wrap-ms-flex-flowcolumn wrapflex-flowcolumn3
0 autoflex13
lipositionrelativemargin0padding0media only3
min-width 960pxcss-xtiwhs3
lifocus-within ehq69sx0margin-top0positionabsolutemedia3
header main3
viewbox0 03
0 auto-ms-flex13
auto-ms-flex1 03
autoflex1 03
448 var--lineheightsunitless-teapotmedium3
0 05rem3
solid d1d0cfborder-radius4pxpadding1remoutlinenonecolor322744-webkit-transitionborder-color3
d1d0cfborder-radius4pxpadding1remoutlinenonecolor322744-webkit-transitionborder-color 300mstransitionborder-color3
448 calcvar--fontsizesunitless-teapotmedium3
calcvar--fontsizesunitless-teapotmedium var--fontsizesunitless-teapotsmall3
var--fontsizesunitless-teapotsmall var--fontsizes-teapotsmallline-heightcalc100vw3
auto content3
var--fontsizes-teapotsmallline-heightcalc100vw 320px3
marginright minmaxvar--space-viewportl100pagemargin3
min-width582
320px308
0308
1199
screen165
only156
02s102
var--lineheightsunitless-ladlemedium66
0px58
properties54
3px44
solid37
ease-in-outbackground34
linearbox-shadow34
var--lineheights-ladlesmallmedia33
var--fontsizes-ladlesmallline-heightcalc100vw33
var--fontsizesunitless-ladlesmall33
var--lineheightsunitless-ladlesmall33
calcvar--fontsizesunitless-ladlemedium33
calcvar--fontsizesunitless-ladlelarge33
var--fontsizesunitless-ladlemedium33
233
333
rgba5033
var--fontsizes-ladlemediumline-heightcalc100vw33
var--lineheightsunitless-ladlelarge33
var--lineheights-ladlemediummedia33
function31
if31
1px30
const28
auto24
var--lineheightsunitless-whiskmedium24
8px23
header21
return21
1rem20
05rem19
lineartransitionall17
footer15
linearcursorpointerwidthautopadding075rem15
property15
768pxmedia15
var--lineheightsunitless-platemedium14
var--fontsizesunitless-whiskmedium12
var--fontsizes-whiskmediumline-heightcalc100vw12
var--fontsizes-whisksmallline-heightcalc100vw12
var--lineheightsunitless-whisklarge12
var--lineheights-whiskmediummedia12
var--fontsizesunitless-whisksmall12
calcvar--fontsizesunitless-whiskmedium12
var--lineheightsunitless-whisksmall12
calcvar--fontsizesunitless-whisklarge12
var--lineheights-whisksmallmedia12
var--lineheightsunitless-mugmedium12
span11
0320px11
content11
marginright10
var--sizes-xs20010
var--lineheightsunitless-kettlemedium10
04background-colortransparentborder-colorrgba1287024110
value9
15rem9
-8px9
var--lineheightsunitless-forkmedium8
main8
prefers-reduced-motion8
home8
var--lineheights-platesmallmedia7
0media7
var--lineheights-platemediummedia7
you7
your7
init7
075rem7
0080px7
-05rem7
1remmedia7
else7
max-width7
var--lineheightsunitless-platelarge7
var--fontsizesunitless-platesmall7
var--fontsizes-platemediumline-heightcalc100vw7
var--fontsizesunitless-platemedium7
calcvar--fontsizesunitless-platelarge7
var--lineheightsunitless-platesmall7
var--fontsizes-platesmallline-heightcalc100vw7
calcvar--fontsizesunitless-platemedium7
var--fontsizesunitless-mugsmall6
var--fontsizes-mugsmallline-heightcalc100vw6
type6
name6
var--lineheightsunitless-mugsmall6
var--lineheights-mugsmallmedia6
exact6
match6
get6
apikey6
apiurl6
var--lineheights-mugmediummedia6
var--lineheightsunitless-teapotmedium6
ismenuopen6
new6
calcvar--fontsizesunitless-muglarge6
var--fontsizesunitless-mugmedium6
var--fontsizes-mugmediumline-heightcalc100vw6
var--lineheightsunitless-muglarge6
calcvar--fontsizesunitless-mugmedium6
customattribute6
e15xmjtm56
46
transparentfontinheritfont-weight600-webkit-text-decorationnonetext-decorationnoneletter-spacinginherit-webkit-appearancenone-moz-appearancenone-ms-appearancenoneappearancenonemin-width140pxtext-aligncenter-webkit-transitionall6
bottomrail6
minmaxvar--space-viewportl100pagemargin6
lifocus-within6
2rem6
55
homes5
65
var--lineheights-kettlemediummedia5
we5
var--fontsizes-kettlemediumline-heightcalc100vw5
var--fontsizesunitless-kettlemedium5
calcvar--fontsizesunitless-kettlelarge5
var--lineheights-kettlesmallmedia5
var--lineheightsunitless-kettlesmall5
var--fontsizes-kettlesmallline-heightcalc100vw5
var--fontsizesunitless-kettlesmall5
css-1er5vgl5
var--lineheightsunitless-kettlelarge5
calcvar--fontsizesunitless-kettlemedium5
close5
no5
322744520px5
but5
may5
know5
more5
all5
rent5
sale5
zoopla4
fac8f0importantmedia4
var--lineheightsunitless-toastermedium4
getallheadersforeachfunction4
toprail4
74
h2font-sizecalc100vw4
1024pxc-diahiv4
saleuk4
limited4
var--lineheightsunitless-forklarge4
e15xmjtm34
our4
true4
uk4
amp4
can4
ismobile4
ismobilemenuopen4
open4
div4
full4
0040px4
really4
var--fontsizes-forkmediumline-heightcalc100vw4
calcvar--fontsizesunitless-forkmedium4
var--lineheightsunitless-knifemedium4
body4
960pxcss-1od8khq4
var--fontsizesunitless-forkmedium4
calcvar--fontsizesunitless-forklarge4
var--lineheights-forksmallmedia4
var--lineheightsunitless-forksmall4
var--lineheightsunitless-spoonmedium4
easetransition05s4
var--fontsizes-forksmallline-heightcalc100vw4
footermedia4
84
var--fontsizesunitless-forksmall4
ease4
var--lineheights-forkmediummedia4
wrapflex-flowrow3
saleto3
var--fontsizes-teapotmediumline-heightcalc100vw3
nowrapflex-flowcolumn3
var--lineheightsunitless-teapotlarge3
var--lineheights-teapotmediummedia3
isloggedin3
nextsibling3
wrap-webkit-flex-flowrow3
browser3
up3
issigninpage3
wrap-ms-flex-flowrow3
windowlocationpathname3
xmlnshttpwwww3org2000svg3
local3
interest3
3227440a0px3
nowrap-webkit-flex-flowcolumn3
nowrap-ms-flex-flowcolumn3
out3
calcvar--fontsizesunitless-teapotmedium3
price3
var--fontsizesunitless-teapotsmall3
rises3
rate3
speech3
free3
now3
average3
var--fontsizes-teapotsmallline-heightcalc100vw3
across3
market3
var--lineheightsunitless-teapotsmall3
var--lineheights-teapotsmallmedia3
calcvar--fontsizesunitless-teapotlarge3
hamburgerelementdatasetkey3
var--fontsizesunitless-teapotmedium3
towns3
menu3
dataattributevalue3
zooplasaved3
322744border-bottom1px3
300mstransitionborder-color3
d1d0cfborder-radius4pxpadding1remoutlinenonecolor322744-webkit-transitionborder-color3
settingssign3
account3
preferencesmore3
searchesemail3
propertiesalerts3
listingstracked3
inmy3
estate3
ehq69sx0margin-top0positionabsolutemedia3
1024pxmedia3
768pxc-diahiv3
320pxc-diahiv3
autoflex13
lidata-is-logged-intruedisplaynonedata-is-logged-in3
var--sizes-viewportmaxwidth3
auto-ms-flex13
93
commercial3
house3
var--space-viewportm100pagemarginmedia3
buttoncss-ezbdl8-buttonlink-button3
var--space-viewportm100pagemargin3
var--space-viewports100pagemargin3
viewbox03
103
autogrid-template-columnsmarginleft3
openedtrackingvalue3
burger3
closedtrackingvalue3
113
hidden3
960pxcss-xtiwhs3
documentbodystyleoverflow3
setoverflow3
wrap-webkit-flex-flowcolumn3
rail3
null3
wrap-ms-flex-flowcolumn3
wrapflex-flowcolumn3
timeout3
lipositionrelativemargin0padding0media3
need3
lihover3

Who hosts Zoopla.co.uk?

Zoopla.co.uk Hosting Provider Information

Hosted IP Address:54.194.89.89
Hosted Hostname:ec2-54-194-89-89.eu-west-1.compute.amazonaws.
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:unknown

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
Amazon.com, Inc.
0.6275%

Zoopla.co.uk Domain Nameserver Information

HostIP AddressCountry
ns-1445.awsdns-52.org 205.251.197.165
ns-1625.awsdns-11.co.uk 205.251.198.89
ns-188.awsdns-23.com 205.251.192.188
ns-775.awsdns-32.net 205.251.195.7

Websites with Similar Names

Zoopla.co.uk
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents
Zoopla.com
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents
Zoopla.info
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents
Zoopla.london
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents
Zoopla.net
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents
Zoopla.org
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents
Zoopla.pro
Zoopla > Search Property to Buy, Rent, House Prices, Estate Agents

Recently Updated Websites

Passwordsafe.sourceforge.net (5 seconds ago.)Total-soft.pe.hu (7 seconds ago.)Sjzdantuoji.com (8 seconds ago.)Kb.indexexchange.com (9 seconds ago.)Outandbeyond.com (9 seconds ago.)Maisonetdemeure.com (9 seconds ago.)Bitespresso.de (10 seconds ago.)Games.jmir.org (11 seconds ago.)Emilymorse.libsyn.com (11 seconds ago.)Wildkaiser.com (12 seconds ago.)Bremicker-vt.de (13 seconds ago.)Citiesspeak.org (13 seconds ago.)Mnftiu.cc (13 seconds ago.)Jaymeesrp.com (14 seconds ago.)Ourcatholicneighborhood.us (14 seconds ago.)Specifierreview.com (15 seconds ago.)Balancedteam.org (15 seconds ago.)Patialahome.com (15 seconds ago.)Experoinc.com (15 seconds ago.)Knitgrammer.com (16 seconds ago.)Ornellaia.com (18 seconds ago.)De.pornhub.com (18 seconds ago.)Carriehaddadgallery.com (18 seconds ago.)Plumbingbros.com.au (20 seconds ago.)Diplomatique.org.br (20 seconds ago.)Bohmeclothes.com (22 seconds ago.)Villagekey.com (22 seconds ago.)Longtermcarecanada.com (22 seconds ago.)Linkyouth.org (24 seconds ago.)Srilanka.unfpa.org (25 seconds ago.)

Recently Searched Keywords

media and press relations (1 second ago.)menghadapi masalah menjelang pernikahan (1 second ago.)kj proweb hosting (1 second ago.)egyptian consulate dubai (2 seconds ago.)o ngc (4 seconds ago.)auto width (4 seconds ago.)min read hot (4 seconds ago.)abasta (4 seconds ago.)marketsmith (4 seconds ago.)宠物类诊断试剂 (5 seconds ago.)soc-font-icon page icon-with-text-shortcodeicon-text-id-80f99842ab3bfa98abb04f4eceeed1de (5 seconds ago.)optim-c (5 seconds ago.)comp-kj0etmayrcomp-kj0etfcq-container positionrelative comp-kj0etmayrcomp-kj0etfcv4 (5 seconds ago.)teamtrenkle (6 seconds ago.)denim prairie (6 seconds ago.)compare plans of airtel and jio (6 seconds ago.)khaleesi (7 seconds ago.)fitoterapia (7 seconds ago.)your house made perfect season 3 (7 seconds ago.)kalkan turkey (8 seconds ago.)smyyehoydsbw---size-4-tinyoydsbw--upgradenotoydsbw--mobilefontnormal normal normal (9 seconds ago.)coasterforce (10 seconds ago.)digitalbrille (10 seconds ago.)aceites vegetales (10 seconds ago.)mingshi international trading l.l.c (10 seconds ago.)lohko (10 seconds ago.)sprzedajemypl (11 seconds ago.)u043fu043eu0437u0438u0446u0438u0438 2d (12 seconds ago.)心理测试游戏 (12 seconds ago.)couture 14 (12 seconds ago.)